Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 454528..455318 | Replicon | plasmid pAt15-1187-1-2a1 |
Accession | NZ_CP123840 | ||
Organism | Agrobacterium fabacearum strain 15-1187-1-2a |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | A6U93_RS26095 | Protein ID | WP_065660620.1 |
Coordinates | 454821..455318 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A8A5PI45 |
Locus tag | A6U93_RS26090 | Protein ID | WP_035200890.1 |
Coordinates | 454528..454824 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A6U93_RS26070 (A6U93_26070) | 449927..451651 | + | 1725 | WP_065660622.1 | ABC transporter ATP-binding protein | - |
A6U93_RS26075 (A6U93_26075) | 451696..452883 | + | 1188 | WP_013637437.1 | galactarate dehydratase | - |
A6U93_RS26080 (A6U93_26080) | 452870..453736 | + | 867 | WP_065660621.1 | aldose 1-epimerase | - |
A6U93_RS26085 (A6U93_26085) | 453948..454345 | + | 398 | Protein_457 | DDE-type integrase/transposase/recombinase | - |
A6U93_RS26090 (A6U93_26090) | 454528..454824 | + | 297 | WP_035200890.1 | DUF1778 domain-containing protein | Antitoxin |
A6U93_RS26095 (A6U93_26095) | 454821..455318 | + | 498 | WP_065660620.1 | GNAT family N-acetyltransferase | Toxin |
A6U93_RS26100 (A6U93_26100) | 455597..456262 | - | 666 | WP_081308998.1 | GNAT family N-acetyltransferase | - |
A6U93_RS26105 (A6U93_26105) | 456228..457388 | - | 1161 | WP_065660619.1 | Gfo/Idh/MocA family oxidoreductase | - |
A6U93_RS26110 (A6U93_26110) | 457420..458670 | - | 1251 | WP_065660618.1 | ROK family transcriptional regulator | - |
A6U93_RS26115 (A6U93_26115) | 458883..459842 | + | 960 | WP_065660617.1 | extracellular solute-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..659230 | 659230 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17813.43 Da Isoelectric Point: 6.8629
>T279156 WP_065660620.1 NZ_CP123840:454821-455318 [Agrobacterium fabacearum]
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALVSGFVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
VTLSAPVPLADHHELAEFNSGVPELDDWLRRRARANQAGGASRTFVVCDESRVIAYYALVSGFVKPPEVPGRFRRNMPDP
IPVAVLGRLAIDQSCQGRGIGRALVRDAGLRLLNAAEVLGIRGVLVHAISDDARAFYEAVGFLSSPSDPMMLMVGLHDLN
NALNT
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|