Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 442032..442702 | Replicon | plasmid pAt15-1187-1-2a1 |
| Accession | NZ_CP123840 | ||
| Organism | Agrobacterium fabacearum strain 15-1187-1-2a | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | A6U93_RS26035 | Protein ID | WP_003517201.1 |
| Coordinates | 442283..442702 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | F0LGD9 |
| Locus tag | A6U93_RS26030 | Protein ID | WP_003517203.1 |
| Coordinates | 442032..442286 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A6U93_RS26020 (A6U93_26020) | 439506..440507 | + | 1002 | WP_003517209.1 | sensor histidine kinase | - |
| A6U93_RS26025 (A6U93_26025) | 441043..441648 | - | 606 | WP_003517207.1 | J domain-containing protein | - |
| A6U93_RS26030 (A6U93_26030) | 442032..442286 | + | 255 | WP_003517203.1 | plasmid stabilization protein | Antitoxin |
| A6U93_RS26035 (A6U93_26035) | 442283..442702 | + | 420 | WP_003517201.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| A6U93_RS26040 (A6U93_26040) | 442842..443738 | - | 897 | WP_013637432.1 | dihydrodipicolinate synthase family protein | - |
| A6U93_RS26045 (A6U93_26045) | 443771..444652 | - | 882 | WP_065660624.1 | SMP-30/gluconolactonase/LRE family protein | - |
| A6U93_RS26050 (A6U93_26050) | 444709..445428 | - | 720 | WP_003517195.1 | FCD domain-containing protein | - |
| A6U93_RS26055 (A6U93_26055) | 445728..447677 | + | 1950 | WP_065660623.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..659230 | 659230 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15036.22 Da Isoelectric Point: 5.1532
>T279155 WP_003517201.1 NZ_CP123840:442283-442702 [Agrobacterium fabacearum]
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
MILLDTNVISEPWKPVPDEAVIAWLDAQAVETLFISAITIAELRFGIAAMPSGRRQTILRDRLEGEVLPHFSGRILSFDL
TTSQFYSELMARARASGKAIGTADGYIAATAAANGLTISTRDTSPFEAAGVKVINPWSR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|