Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 166398..166945 | Replicon | plasmid pAt15-1187-1-2a1 |
| Accession | NZ_CP123840 | ||
| Organism | Agrobacterium fabacearum strain 15-1187-1-2a | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | A6U93_RS24625 | Protein ID | WP_081308828.1 |
| Coordinates | 166652..166945 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | A6U93_RS24620 | Protein ID | WP_065659084.1 |
| Coordinates | 166398..166652 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A6U93_RS24605 (A6U93_24605) | 163290..163781 | + | 492 | WP_065659082.1 | nitrate reductase cytochrome c-type subunit | - |
| A6U93_RS24610 (A6U93_24610) | 163784..164479 | + | 696 | WP_272479405.1 | cytochrome c3 family protein | - |
| A6U93_RS24615 (A6U93_24615) | 164964..166202 | + | 1239 | WP_065659083.1 | Fic family protein | - |
| A6U93_RS24620 (A6U93_24620) | 166398..166652 | + | 255 | WP_065659084.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| A6U93_RS24625 (A6U93_24625) | 166652..166945 | + | 294 | WP_081308828.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| A6U93_RS24630 (A6U93_24630) | 167020..167253 | - | 234 | WP_065659086.1 | hypothetical protein | - |
| A6U93_RS24635 (A6U93_24635) | 167723..168445 | + | 723 | WP_158007500.1 | UTRA domain-containing protein | - |
| A6U93_RS24640 (A6U93_24640) | 168598..169725 | + | 1128 | WP_065659087.1 | ABC transporter ATP-binding protein | - |
| A6U93_RS24645 (A6U93_24645) | 169715..170359 | + | 645 | WP_065659088.1 | ABC transporter permease subunit | - |
| A6U93_RS24650 (A6U93_24650) | 170364..171101 | + | 738 | WP_065659089.1 | ABC transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..659230 | 659230 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11157.88 Da Isoelectric Point: 6.6028
>T279154 WP_081308828.1 NZ_CP123840:166652-166945 [Agrobacterium fabacearum]
MPFSLSVQAEEDIISIAEECIRIFGALVARQYHGELFALLELIATNPRMARERHEISPPVRIHPFKAHLVVYRIIEDGSV
FVIRIRHGHEHWAGDSF
MPFSLSVQAEEDIISIAEECIRIFGALVARQYHGELFALLELIATNPRMARERHEISPPVRIHPFKAHLVVYRIIEDGSV
FVIRIRHGHEHWAGDSF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|