Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 1343050..1343584 | Replicon | chromosome |
| Accession | NZ_CP123784 | ||
| Organism | Minwuia sp. IMCC4030 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | QGV56_RS06205 | Protein ID | WP_281018586.1 |
| Coordinates | 1343050..1343349 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | QGV56_RS06210 | Protein ID | WP_281018585.1 |
| Coordinates | 1343339..1343584 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QGV56_RS06180 | 1339363..1339596 | - | 234 | WP_281018591.1 | hypothetical protein | - |
| QGV56_RS06185 | 1339689..1339955 | - | 267 | WP_281018590.1 | hypothetical protein | - |
| QGV56_RS06190 | 1340117..1340965 | + | 849 | WP_281018589.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
| QGV56_RS06195 | 1341047..1341850 | + | 804 | WP_281018588.1 | SDR family oxidoreductase | - |
| QGV56_RS06200 | 1341862..1343013 | + | 1152 | WP_281018587.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
| QGV56_RS06205 | 1343050..1343349 | - | 300 | WP_281018586.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QGV56_RS06210 | 1343339..1343584 | - | 246 | WP_281018585.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| QGV56_RS06215 | 1343738..1345273 | + | 1536 | WP_281018584.1 | acetyl-CoA acetyltransferase | - |
| QGV56_RS06220 | 1345270..1346508 | + | 1239 | WP_281018583.1 | MFS transporter | - |
| QGV56_RS06225 | 1346546..1347250 | + | 705 | WP_281018582.1 | SDR family oxidoreductase | - |
| QGV56_RS06230 | 1347290..1348204 | - | 915 | WP_281018581.1 | alpha/beta hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11487.98 Da Isoelectric Point: 6.4822
>T279153 WP_281018586.1 NZ_CP123784:c1343349-1343050 [Minwuia sp. IMCC4030]
MPDSDPGYRLSPLARTDLEDIWRYTFENWSLEQADRYHGTIMTAILALADGSVSGSRADVREGYFKLRAGSHVLFYRKAD
TTLEIMRILHQRMDVDRHL
MPDSDPGYRLSPLARTDLEDIWRYTFENWSLEQADRYHGTIMTAILALADGSVSGSRADVREGYFKLRAGSHVLFYRKAD
TTLEIMRILHQRMDVDRHL
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|