Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 720170..720704 | Replicon | chromosome |
Accession | NZ_CP123783 | ||
Organism | Minwuia sp. IMCC3077 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QGV02_RS03530 | Protein ID | WP_281018586.1 |
Coordinates | 720405..720704 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | QGV02_RS03525 | Protein ID | WP_281018585.1 |
Coordinates | 720170..720415 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QGV02_RS03505 | 715550..716464 | + | 915 | WP_281018581.1 | alpha/beta hydrolase | - |
QGV02_RS03510 | 716504..717208 | - | 705 | WP_281018582.1 | SDR family oxidoreductase | - |
QGV02_RS03515 | 717246..718484 | - | 1239 | WP_281018583.1 | MFS transporter | - |
QGV02_RS03520 | 718481..720016 | - | 1536 | WP_281018584.1 | acetyl-CoA acetyltransferase | - |
QGV02_RS03525 | 720170..720415 | + | 246 | WP_281018585.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QGV02_RS03530 | 720405..720704 | + | 300 | WP_281018586.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QGV02_RS03535 | 720741..721892 | - | 1152 | WP_281018587.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
QGV02_RS03540 | 721904..722707 | - | 804 | WP_281018588.1 | SDR family oxidoreductase | - |
QGV02_RS03545 | 722789..723637 | - | 849 | WP_281018589.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
QGV02_RS03550 | 723799..724065 | + | 267 | WP_281018590.1 | hypothetical protein | - |
QGV02_RS03555 | 724158..724391 | + | 234 | WP_281018591.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11487.98 Da Isoelectric Point: 6.4822
>T279152 WP_281018586.1 NZ_CP123783:720405-720704 [Minwuia sp. IMCC3077]
MPDSDPGYRLSPLARTDLEDIWRYTFENWSLEQADRYHGTIMTAILALADGSVSGSRADVREGYFKLRAGSHVLFYRKAD
TTLEIMRILHQRMDVDRHL
MPDSDPGYRLSPLARTDLEDIWRYTFENWSLEQADRYHGTIMTAILALADGSVSGSRADVREGYFKLRAGSHVLFYRKAD
TTLEIMRILHQRMDVDRHL
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|