Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 406982..407516 | Replicon | chromosome |
Accession | NZ_CP123781 | ||
Organism | Minwuia sp. IMCC3009 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | QGV55_RS01800 | Protein ID | WP_281018586.1 |
Coordinates | 406982..407281 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | QGV55_RS01805 | Protein ID | WP_281018585.1 |
Coordinates | 407271..407516 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QGV55_RS01775 | 403295..403528 | - | 234 | WP_281018591.1 | hypothetical protein | - |
QGV55_RS01780 | 403621..403887 | - | 267 | WP_281018590.1 | hypothetical protein | - |
QGV55_RS01785 | 404049..404897 | + | 849 | WP_281018589.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
QGV55_RS01790 | 404979..405782 | + | 804 | WP_281018588.1 | SDR family oxidoreductase | - |
QGV55_RS01795 | 405794..406945 | + | 1152 | WP_281018587.1 | NADH:flavin oxidoreductase/NADH oxidase | - |
QGV55_RS01800 | 406982..407281 | - | 300 | WP_281018586.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QGV55_RS01805 | 407271..407516 | - | 246 | WP_281018585.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
QGV55_RS01810 | 407670..409205 | + | 1536 | WP_281018584.1 | acetyl-CoA acetyltransferase | - |
QGV55_RS01815 | 409202..410440 | + | 1239 | WP_281018583.1 | MFS transporter | - |
QGV55_RS01820 | 410478..411182 | + | 705 | WP_281018582.1 | SDR family oxidoreductase | - |
QGV55_RS01825 | 411222..412136 | - | 915 | WP_281018581.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11487.98 Da Isoelectric Point: 6.4822
>T279150 WP_281018586.1 NZ_CP123781:c407281-406982 [Minwuia sp. IMCC3009]
MPDSDPGYRLSPLARTDLEDIWRYTFENWSLEQADRYHGTIMTAILALADGSVSGSRADVREGYFKLRAGSHVLFYRKAD
TTLEIMRILHQRMDVDRHL
MPDSDPGYRLSPLARTDLEDIWRYTFENWSLEQADRYHGTIMTAILALADGSVSGSRADVREGYFKLRAGSHVLFYRKAD
TTLEIMRILHQRMDVDRHL
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|