Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2307976..2308498 | Replicon | chromosome |
Accession | NZ_CP123771 | ||
Organism | Pseudomonas viciae strain YsS1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QCD61_RS10380 | Protein ID | WP_135844720.1 |
Coordinates | 2308214..2308498 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QCD61_RS10375 | Protein ID | WP_135844719.1 |
Coordinates | 2307976..2308224 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QCD61_RS10360 (QCD61_10360) | 2304400..2305401 | + | 1002 | WP_280944826.1 | AAA family ATPase | - |
QCD61_RS10365 (QCD61_10365) | 2305503..2306057 | + | 555 | WP_280944959.1 | VWA domain-containing protein | - |
QCD61_RS10370 (QCD61_10370) | 2306263..2307909 | + | 1647 | WP_135844718.1 | phospholipase D-like domain-containing protein | - |
QCD61_RS10375 (QCD61_10375) | 2307976..2308224 | + | 249 | WP_135844719.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QCD61_RS10380 (QCD61_10380) | 2308214..2308498 | + | 285 | WP_135844720.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QCD61_RS10385 (QCD61_10385) | 2308607..2308948 | + | 342 | WP_280944827.1 | hypothetical protein | - |
QCD61_RS10390 (QCD61_10390) | 2309373..2310221 | + | 849 | WP_135844722.1 | transporter substrate-binding domain-containing protein | - |
QCD61_RS10395 (QCD61_10395) | 2310276..2310938 | + | 663 | WP_135844723.1 | amino acid ABC transporter permease | - |
QCD61_RS10400 (QCD61_10400) | 2310948..2311610 | + | 663 | WP_135844724.1 | amino acid ABC transporter permease | - |
QCD61_RS10405 (QCD61_10405) | 2311607..2312413 | + | 807 | WP_256452553.1 | amino acid ABC transporter ATP-binding protein | - |
QCD61_RS10410 (QCD61_10410) | 2312451..2312840 | + | 390 | WP_135844726.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10946.63 Da Isoelectric Point: 10.2243
>T279148 WP_135844720.1 NZ_CP123771:2308214-2308498 [Pseudomonas viciae]
MTYELEFSDKAWKEWQKLGATLRAQFKKKLEERLENPHVQADRLHGLGNAYKIKLRNAGYRLVYRVVDDLLVVTVIGVGK
RERGQVYDEAAAKR
MTYELEFSDKAWKEWQKLGATLRAQFKKKLEERLENPHVQADRLHGLGNAYKIKLRNAGYRLVYRVVDDLLVVTVIGVGK
RERGQVYDEAAAKR
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|