Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 267766..268442 | Replicon | chromosome |
| Accession | NZ_CP123771 | ||
| Organism | Pseudomonas viciae strain YsS1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QCD61_RS01130 | Protein ID | WP_135843170.1 |
| Coordinates | 267766..267948 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QCD61_RS01135 | Protein ID | WP_135847931.1 |
| Coordinates | 268041..268442 (+) | Length | 134 a.a. |
Genomic Context
Location: 263803..265764 (1962 bp)
Type: Others
Protein ID: WP_178084290.1
Type: Others
Protein ID: WP_178084290.1
Location: 266746..267636 (891 bp)
Type: Others
Protein ID: WP_135843169.1
Type: Others
Protein ID: WP_135843169.1
Location: 267766..267948 (183 bp)
Type: Toxin
Protein ID: WP_135843170.1
Type: Toxin
Protein ID: WP_135843170.1
Location: 268041..268442 (402 bp)
Type: Antitoxin
Protein ID: WP_135847931.1
Type: Antitoxin
Protein ID: WP_135847931.1
Location: 268508..269545 (1038 bp)
Type: Others
Protein ID: WP_135843171.1
Type: Others
Protein ID: WP_135843171.1
Location: 265888..266628 (741 bp)
Type: Others
Protein ID: WP_135843168.1
Type: Others
Protein ID: WP_135843168.1
Location: 269602..270444 (843 bp)
Type: Others
Protein ID: WP_135843172.1
Type: Others
Protein ID: WP_135843172.1
Location: 270495..271334 (840 bp)
Type: Others
Protein ID: WP_256454055.1
Type: Others
Protein ID: WP_256454055.1
Location: 271331..272125 (795 bp)
Type: Others
Protein ID: WP_265072583.1
Type: Others
Protein ID: WP_265072583.1
Location: 272151..273128 (978 bp)
Type: Others
Protein ID: WP_135843175.1
Type: Others
Protein ID: WP_135843175.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QCD61_RS01115 (QCD61_01115) | 263803..265764 | + | 1962 | WP_178084290.1 | choline transporter BetT | - |
| QCD61_RS01120 (QCD61_01120) | 265888..266628 | - | 741 | WP_135843168.1 | SDR family oxidoreductase | - |
| QCD61_RS01125 (QCD61_01125) | 266746..267636 | + | 891 | WP_135843169.1 | LysR family transcriptional regulator | - |
| QCD61_RS01130 (QCD61_01130) | 267766..267948 | + | 183 | WP_135843170.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QCD61_RS01135 (QCD61_01135) | 268041..268442 | + | 402 | WP_135847931.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QCD61_RS01140 (QCD61_01140) | 268508..269545 | + | 1038 | WP_135843171.1 | L-glyceraldehyde 3-phosphate reductase | - |
| QCD61_RS01145 (QCD61_01145) | 269602..270444 | - | 843 | WP_135843172.1 | taurine dioxygenase | - |
| QCD61_RS01150 (QCD61_01150) | 270495..271334 | - | 840 | WP_256454055.1 | taurine ABC transporter permease TauC | - |
| QCD61_RS01155 (QCD61_01155) | 271331..272125 | - | 795 | WP_265072583.1 | taurine ABC transporter ATP-binding subunit | - |
| QCD61_RS01160 (QCD61_01160) | 272151..273128 | - | 978 | WP_135843175.1 | taurine ABC transporter substrate-binding protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6871.99 Da Isoelectric Point: 10.6627
>T279145 WP_135843170.1 NZ_CP123771:267766-267948 [Pseudomonas viciae]
MRSREMIRKIEEDGWYLVAVKGSHHQYKHSFKAGRVTIKHPDADLPKGTINSILKQAGLK
MRSREMIRKIEEDGWYLVAVKGSHHQYKHSFKAGRVTIKHPDADLPKGTINSILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14625.30 Da Isoelectric Point: 4.4085
>AT279145 WP_135847931.1 NZ_CP123771:268041-268442 [Pseudomonas viciae]
MKFPVVLHKDADSEYGVTVPDVPGCFSAGSTVGQAFENVKEALSLHYEGLVADGEPLPQIHEIDDHLDNPDYAGGIWGVV
EFDVTPYFGKSVRFNATLPEQLLERIDQTVRRDQRYSSRSGFLAAAALRELSA
MKFPVVLHKDADSEYGVTVPDVPGCFSAGSTVGQAFENVKEALSLHYEGLVADGEPLPQIHEIDDHLDNPDYAGGIWGVV
EFDVTPYFGKSVRFNATLPEQLLERIDQTVRRDQRYSSRSGFLAAAALRELSA
Download Length: 402 bp