Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 3166..3750 | Replicon | plasmid pAP8900-1 |
| Accession | NZ_CP123766 | ||
| Organism | Acinetobacter pittii strain AP8900 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | N9JY46 |
| Locus tag | QFB56_RS19340 | Protein ID | WP_000286963.1 |
| Coordinates | 3448..3750 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | QFB56_RS19335 | Protein ID | WP_000985610.1 |
| Coordinates | 3166..3447 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB56_RS19310 (QFB56_19310) | 288..506 | + | 219 | WP_029747731.1 | hypothetical protein | - |
| QFB56_RS19315 (QFB56_19315) | 616..825 | - | 210 | WP_000069471.1 | hypothetical protein | - |
| QFB56_RS19320 (QFB56_19320) | 818..1120 | - | 303 | WP_001140619.1 | XRE family transcriptional regulator | - |
| QFB56_RS19325 (QFB56_19325) | 1113..1469 | - | 357 | WP_006581604.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QFB56_RS19330 (QFB56_19330) | 2090..2962 | - | 873 | WP_006581603.1 | restriction endonuclease | - |
| QFB56_RS19335 (QFB56_19335) | 3166..3447 | - | 282 | WP_000985610.1 | putative addiction module antidote protein | Antitoxin |
| QFB56_RS19340 (QFB56_19340) | 3448..3750 | - | 303 | WP_000286963.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFB56_RS19345 (QFB56_19345) | 3942..4334 | + | 393 | WP_228713465.1 | hypothetical protein | - |
| QFB56_RS19350 (QFB56_19350) | 4346..5278 | - | 933 | WP_002048759.1 | IS5 family transposase | - |
| QFB56_RS19355 (QFB56_19355) | 5332..5811 | + | 480 | Protein_9 | GIY-YIG nuclease family protein | - |
| QFB56_RS19360 (QFB56_19360) | 5913..7003 | + | 1091 | WP_085940648.1 | IS4-like element ISAba1 family transposase | - |
| QFB56_RS19365 (QFB56_19365) | 7200..7562 | - | 363 | Protein_11 | plasmid replication DNA-binding protein | - |
| QFB56_RS19370 (QFB56_19370) | 7596..7820 | - | 225 | WP_125510319.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul2 | - | 1..86394 | 86394 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11545.02 Da Isoelectric Point: 4.6838
>T279138 WP_000286963.1 NZ_CP123766:c3750-3448 [Acinetobacter pittii]
MYSIYTTEAFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
MYSIYTTEAFDDWFTKLKDQQAKRRIQVRIDRVEDGNFGDTEPVGEGVSELRFFFGPGYRIYYCKQGQRVVILLAGGDKS
TQSKDIKLALQLAQDLEEEL
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|