Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 906740..907394 | Replicon | chromosome |
Accession | NZ_CP123759 | ||
Organism | Arsenophonus apicola strain aApi_AU |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | QG404_RS05155 | Protein ID | WP_180558768.1 |
Coordinates | 906987..907394 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A4P7KWA0 |
Locus tag | QG404_RS05150 | Protein ID | WP_026821812.1 |
Coordinates | 906740..907006 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QG404_RS05130 (QG404_05135) | 902287..903144 | + | 858 | WP_280939305.1 | hypothetical protein | - |
QG404_RS05135 (QG404_05140) | 903238..904074 | + | 837 | WP_280939306.1 | hypothetical protein | - |
QG404_RS05140 (QG404_05145) | 904324..904656 | + | 333 | WP_280939307.1 | hypothetical protein | - |
QG404_RS05145 (QG404_05150) | 905494..906480 | - | 987 | WP_280939308.1 | tRNA-modifying protein YgfZ | - |
QG404_RS05150 (QG404_05155) | 906740..907006 | + | 267 | WP_026821812.1 | FAD assembly factor SdhE | Antitoxin |
QG404_RS05155 (QG404_05160) | 906987..907394 | + | 408 | WP_180558768.1 | protein YgfX | Toxin |
QG404_RS05160 (QG404_05165) | 907410..907928 | - | 519 | WP_280939309.1 | flavodoxin FldB | - |
QG404_RS05165 (QG404_05170) | 908411..909724 | - | 1314 | WP_280939310.1 | S8 family serine peptidase | - |
QG404_RS05170 (QG404_05175) | 911373..912284 | + | 912 | WP_180558772.1 | site-specific tyrosine recombinase XerD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15888.82 Da Isoelectric Point: 10.8101
>T279134 WP_180558768.1 NZ_CP123759:906987-907394 [Arsenophonus apicola]
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSLVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
VVLWKFNINVSWLTQLFSTGVHVGIGLLVFFSSWPPNNLVTWLIATLLIVASWVRSQKNISRCKGSLVLLNGNKIQWKKS
EWLIVKKPWFCFFGVKLTLRSWQCNKRIRLWIASDSMPEEEWRNLNQLLLQYPDI
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|