Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 42539..43074 Replicon plasmid paApi_AU1
Accession NZ_CP123757
Organism Arsenophonus apicola strain aApi_AU

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QG404_RS00530 Protein ID WP_280937018.1
Coordinates 42787..43074 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QG404_RS00525 Protein ID WP_280937017.1
Coordinates 42539..42790 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QG404_RS00500 (QG404_00500) 38288..38545 + 258 WP_280937013.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
QG404_RS00505 (QG404_00505) 38545..38976 + 432 WP_280937014.1 type II toxin-antitoxin system VapC family toxin -
QG404_RS00510 (QG404_00515) 39582..40790 - 1209 WP_280937015.1 transposase -
QG404_RS00515 (QG404_00520) 40813..41229 + 417 WP_280936915.1 IS200/IS605 family transposase -
QG404_RS00520 (QG404_00525) 41337..42431 - 1095 WP_280937016.1 type II secretion system F family protein -
QG404_RS00525 (QG404_00530) 42539..42790 + 252 WP_280937017.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QG404_RS00530 (QG404_00535) 42787..43074 + 288 WP_280937018.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QG404_RS00535 (QG404_00540) 43087..43395 - 309 WP_280937019.1 hypothetical protein -
QG404_RS00540 (QG404_00545) 43444..44592 - 1149 WP_280937020.1 ATPase, T2SS/T4P/T4SS family -
QG404_RS00545 (QG404_00550) 44589..45122 - 534 WP_280937021.1 macro domain-containing protein -
QG404_RS00550 (QG404_00555) 45189..45605 - 417 WP_280936915.1 IS200/IS605 family transposase -
QG404_RS00555 (QG404_00560) 45628..46836 + 1209 WP_280936916.1 transposase -
QG404_RS00560 (QG404_00565) 46908..47453 + 546 WP_280937022.1 type 4 pilus major pilin -
QG404_RS00565 (QG404_00570) 47538..47981 + 444 WP_280937023.1 lytic transglycosylase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..95699 95699
- inside IScluster/Tn - - 39582..50380 10798


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-85)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11174.26 Da        Isoelectric Point: 10.6938

>T279133 WP_280937018.1 NZ_CP123757:42787-43074 [Arsenophonus apicola]
MIYKVKFRTDALKEWNSLDRSIQQQFAKKLKKCAENPHIPTARLRGMQNCYKIKLRSSGFRLVYQIFKDELIIAVVAVGK
REHSEVYKLASKRLC

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9378.58 Da        Isoelectric Point: 4.0543

>AT279133 WP_280937017.1 NZ_CP123757:42539-42790 [Arsenophonus apicola]
MPTTILSTTTASITELKTNPMATVNSGDGYPVAILNRNQPAFYCIPAELYEQMLEFIDDQELANLVKERSEQTLHDVNLD
RYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References