Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2132577..2133160 | Replicon | chromosome |
Accession | NZ_CP123735 | ||
Organism | Lactobacillus kefiranofaciens strain ZW18 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A656Y774 |
Locus tag | QEJ78_RS10685 | Protein ID | WP_025084310.1 |
Coordinates | 2132577..2132915 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A656Y737 |
Locus tag | QEJ78_RS10690 | Protein ID | WP_013851202.1 |
Coordinates | 2132909..2133160 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEJ78_RS10670 (QEJ78_10680) | 2128238..2129515 | + | 1278 | WP_013851207.1 | ISL3 family transposase | - |
QEJ78_RS10675 (QEJ78_10685) | 2129710..2130888 | - | 1179 | Protein_2059 | IS256 family transposase | - |
QEJ78_RS10680 (QEJ78_10690) | 2131044..2132078 | - | 1035 | WP_013851204.1 | IS30 family transposase | - |
QEJ78_RS10685 (QEJ78_10695) | 2132577..2132915 | - | 339 | WP_025084310.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QEJ78_RS10690 (QEJ78_10700) | 2132909..2133160 | - | 252 | WP_013851202.1 | hypothetical protein | Antitoxin |
QEJ78_RS10695 (QEJ78_10705) | 2133352..2133492 | - | 141 | WP_013851201.1 | hypothetical protein | - |
QEJ78_RS10700 (QEJ78_10710) | 2133797..2134009 | - | 213 | WP_013851199.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
QEJ78_RS10705 (QEJ78_10715) | 2134049..2134639 | - | 591 | WP_013851198.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
QEJ78_RS10710 (QEJ78_10720) | 2134797..2135126 | - | 330 | WP_013851197.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QEJ78_RS10715 (QEJ78_10725) | 2135129..2135374 | - | 246 | WP_013851196.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
QEJ78_RS10720 (QEJ78_10730) | 2135568..2136644 | - | 1077 | WP_013851195.1 | Fic family protein | - |
QEJ78_RS10725 (QEJ78_10735) | 2136877..2137164 | + | 288 | WP_013851194.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
QEJ78_RS10730 (QEJ78_10740) | 2137171..2137452 | + | 282 | WP_013851193.1 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2073796..2153207 | 79411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13056.26 Da Isoelectric Point: 9.8423
>T279131 WP_025084310.1 NZ_CP123735:c2132915-2132577 [Lactobacillus kefiranofaciens]
MVIKQGSVLLMDLSPKQGHEQSGKRPYLYLSYQGVEKYAHIAIFAPISTTKRRYPLYRNLPDSCKTKGVVMLDQLVTVDY
HNRKHQFLEQLPDDYMEKLLKIVKVVFQKDPS
MVIKQGSVLLMDLSPKQGHEQSGKRPYLYLSYQGVEKYAHIAIFAPISTTKRRYPLYRNLPDSCKTKGVVMLDQLVTVDY
HNRKHQFLEQLPDDYMEKLLKIVKVVFQKDPS
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656Y774 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656Y737 |