Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 2132577..2133160 Replicon chromosome
Accession NZ_CP123735
Organism Lactobacillus kefiranofaciens strain ZW18

Toxin (Protein)


Gene name mazF Uniprot ID A0A656Y774
Locus tag QEJ78_RS10685 Protein ID WP_025084310.1
Coordinates 2132577..2132915 (-) Length 113 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A656Y737
Locus tag QEJ78_RS10690 Protein ID WP_013851202.1
Coordinates 2132909..2133160 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEJ78_RS10670 (QEJ78_10680) 2128238..2129515 + 1278 WP_013851207.1 ISL3 family transposase -
QEJ78_RS10675 (QEJ78_10685) 2129710..2130888 - 1179 Protein_2059 IS256 family transposase -
QEJ78_RS10680 (QEJ78_10690) 2131044..2132078 - 1035 WP_013851204.1 IS30 family transposase -
QEJ78_RS10685 (QEJ78_10695) 2132577..2132915 - 339 WP_025084310.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QEJ78_RS10690 (QEJ78_10700) 2132909..2133160 - 252 WP_013851202.1 hypothetical protein Antitoxin
QEJ78_RS10695 (QEJ78_10705) 2133352..2133492 - 141 WP_013851201.1 hypothetical protein -
QEJ78_RS10700 (QEJ78_10710) 2133797..2134009 - 213 WP_013851199.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QEJ78_RS10705 (QEJ78_10715) 2134049..2134639 - 591 WP_013851198.1 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein -
QEJ78_RS10710 (QEJ78_10720) 2134797..2135126 - 330 WP_013851197.1 type II toxin-antitoxin system RelE/ParE family toxin -
QEJ78_RS10715 (QEJ78_10725) 2135129..2135374 - 246 WP_013851196.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
QEJ78_RS10720 (QEJ78_10730) 2135568..2136644 - 1077 WP_013851195.1 Fic family protein -
QEJ78_RS10725 (QEJ78_10735) 2136877..2137164 + 288 WP_013851194.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
QEJ78_RS10730 (QEJ78_10740) 2137171..2137452 + 282 WP_013851193.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2073796..2153207 79411


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-107)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 113 a.a.        Molecular weight: 13056.26 Da        Isoelectric Point: 9.8423

>T279131 WP_025084310.1 NZ_CP123735:c2132915-2132577 [Lactobacillus kefiranofaciens]
MVIKQGSVLLMDLSPKQGHEQSGKRPYLYLSYQGVEKYAHIAIFAPISTTKRRYPLYRNLPDSCKTKGVVMLDQLVTVDY
HNRKHQFLEQLPDDYMEKLLKIVKVVFQKDPS

Download         Length: 339 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9503.84 Da        Isoelectric Point: 9.6573

>AT279131 WP_013851202.1 NZ_CP123735:c2133160-2132909 [Lactobacillus kefiranofaciens]
MITATISKWGNSKGIRLNQAVLQALNAKTGDHLNFKIEDNRVIITKKEPKHELTFEELFKDYKGGSFDTKISLPDERVGN
EKW

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A656Y774

Antitoxin

Source ID Structure
AlphaFold DB A0A656Y737

References