Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Txe-Axe/YoeB-RelB |
| Location | 1827214..1827748 | Replicon | chromosome |
| Accession | NZ_CP123735 | ||
| Organism | Lactobacillus kefiranofaciens strain ZW18 | ||
Toxin (Protein)
| Gene name | Txe | Uniprot ID | - |
| Locus tag | QEJ78_RS09200 | Protein ID | WP_013854792.1 |
| Coordinates | 1827214..1827477 (-) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | Axe | Uniprot ID | A0A656YAM3 |
| Locus tag | QEJ78_RS09205 | Protein ID | WP_013854791.1 |
| Coordinates | 1827461..1827748 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEJ78_RS09180 (QEJ78_09190) | 1822410..1823931 | + | 1522 | Protein_1774 | L-lactate permease | - |
| QEJ78_RS09185 (QEJ78_09195) | 1824105..1824266 | + | 162 | WP_013854794.1 | hypothetical protein | - |
| QEJ78_RS09190 (QEJ78_09200) | 1824966..1825574 | + | 609 | WP_013851264.1 | IS607 family transposase | - |
| QEJ78_RS09195 (QEJ78_09205) | 1825604..1826929 | + | 1326 | WP_013851263.1 | RNA-guided endonuclease TnpB family protein | - |
| QEJ78_RS09200 (QEJ78_09210) | 1827214..1827477 | - | 264 | WP_013854792.1 | Txe/YoeB family addiction module toxin | Toxin |
| QEJ78_RS09205 (QEJ78_09215) | 1827461..1827748 | - | 288 | WP_013854791.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QEJ78_RS09210 (QEJ78_09220) | 1827878..1828354 | - | 477 | WP_013854790.1 | S-ribosylhomocysteine lyase | - |
| QEJ78_RS09215 (QEJ78_09225) | 1828417..1829517 | - | 1101 | WP_013854789.1 | vitamin B12 independent methionine synthase | - |
| QEJ78_RS09220 (QEJ78_09230) | 1830214..1830690 | + | 477 | WP_013854787.1 | hypothetical protein | - |
| QEJ78_RS09225 (QEJ78_09235) | 1830687..1830884 | + | 198 | WP_013854786.1 | helix-turn-helix transcriptional regulator | - |
| QEJ78_RS09230 (QEJ78_09240) | 1830859..1831092 | + | 234 | WP_025084256.1 | bacteriocin immunity protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1704570..1837618 | 133048 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10486.95 Da Isoelectric Point: 9.3821
>T279130 WP_013854792.1 NZ_CP123735:c1827477-1827214 [Lactobacillus kefiranofaciens]
MLSWTDDGCDDYLNWQKQRQKKKIKRINKLITDIKRHPFEGMGKPEGLKNNLTGLWSRKIDAKNRIIYEYTNENVIIYSC
KDHYDDH
MLSWTDDGCDDYLNWQKQRQKKKIKRINKLITDIKRHPFEGMGKPEGLKNNLTGLWSRKIDAKNRIIYEYTNENVIIYSC
KDHYDDH
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|