279128

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 98724..99271 Replicon plasmid pN38232-1
Accession NZ_CP123661
Organism Salmonella enterica subsp. enterica serovar Kentucky strain CVM N38232

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag DE22_RS23435 Protein ID WP_001384452.1
Coordinates 98993..99271 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag DE22_RS23430 Protein ID WP_000079941.1
Coordinates 98724..98993 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DE22_RS23400 (94430) 94430..95233 + 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
DE22_RS23405 (95233) 95233..96069 + 837 WP_000480968.1 aminoglycoside O-phosphotransferase APH(6)-Id -
DE22_RS23410 (96391) 96391..96645 + 255 WP_000083830.1 replication regulatory protein RepA -
DE22_RS23415 (96684) 96684..96920 - 237 WP_223228793.1 replication protein RepA -
DE22_RS23420 (96911) 96911..96958 + 48 WP_077822033.1 hypothetical protein -
DE22_RS23425 (96951) 96951..97808 + 858 WP_000130940.1 incFII family plasmid replication initiator RepA -
DE22_RS23430 (98724) 98724..98993 + 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
DE22_RS23435 (98993) 98993..99271 + 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
DE22_RS23440 (99317) 99317..100165 + 849 WP_001057989.1 3'-5' exonuclease -
DE22_RS23445 (100351) 100351..102231 + 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
DE22_RS23450 (102253) 102253..102588 - 336 WP_001080729.1 colicin 1A immunity protein -
DE22_RS23455 (102835) 102835..103239 + 405 WP_000839181.1 transposase -
DE22_RS23460 (103236) 103236..103583 + 348 WP_000612626.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / tet(B) / aph(3'')-Ib / aph(6)-Id iucA / iucB / iucC / iucD / iutA / iroN / iroE / iroD / iroC / iroB 1..146005 146005


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T279128 WP_001384452.1 NZ_CP123661:98993-99271 [Salmonella enterica subsp. enterica serovar Kentucky]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT279128 WP_000079941.1 NZ_CP123661:98724-98993 [Salmonella enterica subsp. enterica serovar Kentucky]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References