Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4288517..4289298 | Replicon | chromosome |
Accession | NZ_CP123660 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain CVM N38232 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3V9S3T1 |
Locus tag | DE22_RS20685 | Protein ID | WP_000625910.1 |
Coordinates | 4288517..4289008 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A3V4SIN7 |
Locus tag | DE22_RS20690 | Protein ID | WP_001110453.1 |
Coordinates | 4289005..4289298 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DE22_RS20660 (4283653) | 4283653..4286091 | - | 2439 | WP_001014137.1 | F4 (K88) fimbrial usher FaeD | - |
DE22_RS20665 (4286101) | 4286101..4286640 | - | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
DE22_RS20670 (4286675) | 4286675..4286965 | - | 291 | WP_000773469.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
DE22_RS20675 (4287552) | 4287552..4287809 | + | 258 | WP_001112993.1 | hypothetical protein | - |
DE22_RS20680 (4288054) | 4288054..4288302 | - | 249 | Protein_4043 | IS481 family transposase | - |
DE22_RS20685 (4288517) | 4288517..4289008 | - | 492 | WP_000625910.1 | GNAT family N-acetyltransferase | Toxin |
DE22_RS20690 (4289005) | 4289005..4289298 | - | 294 | WP_001110453.1 | DUF1778 domain-containing protein | Antitoxin |
DE22_RS20695 (4289616) | 4289616..4289837 | + | 222 | WP_031617221.1 | hypothetical protein | - |
DE22_RS20700 (4290101) | 4290101..4290976 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
DE22_RS20705 (4290973) | 4290973..4291260 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
DE22_RS20710 (4291253) | 4291253..4291435 | - | 183 | WP_024133183.1 | ATP-binding cassette domain-containing protein | - |
DE22_RS20715 (4291473) | 4291473..4291553 | + | 81 | Protein_4050 | hypothetical protein | - |
DE22_RS20720 (4291663) | 4291663..4291797 | + | 135 | Protein_4051 | hypothetical protein | - |
DE22_RS20725 (4292092) | 4292092..4292997 | - | 906 | WP_001268257.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeI / faeH / faeF / faeE / faeD / faeC | 4277030..4291579 | 14549 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.51 Da Isoelectric Point: 7.7297
>T279125 WP_000625910.1 NZ_CP123660:c4289008-4288517 [Salmonella enterica subsp. enterica serovar Kentucky]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQITGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQITGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10948.57 Da Isoelectric Point: 9.8590
>AT279125 WP_001110453.1 NZ_CP123660:c4289298-4289005 [Salmonella enterica subsp. enterica serovar Kentucky]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V9S3T1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SIN7 |