Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 4173184..4173827 | Replicon | chromosome |
| Accession | NZ_CP123660 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kentucky strain CVM N38232 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B5F3H8 |
| Locus tag | DE22_RS20065 | Protein ID | WP_000048134.1 |
| Coordinates | 4173411..4173827 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B5F3H9 |
| Locus tag | DE22_RS20060 | Protein ID | WP_001261294.1 |
| Coordinates | 4173184..4173414 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DE22_RS20050 (4170198) | 4170198..4172336 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| DE22_RS20055 (4172553) | 4172553..4173017 | + | 465 | WP_001009176.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| DE22_RS20060 (4173184) | 4173184..4173414 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| DE22_RS20065 (4173411) | 4173411..4173827 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| DE22_RS20070 (4173888) | 4173888..4175801 | - | 1914 | WP_001212141.1 | BglG family transcription antiterminator | - |
| DE22_RS20075 (4175818) | 4175818..4176558 | - | 741 | WP_000779262.1 | KDGP aldolase family protein | - |
| DE22_RS20080 (4176555) | 4176555..4177673 | - | 1119 | WP_001139172.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| DE22_RS20085 (4177657) | 4177657..4178790 | - | 1134 | WP_000459943.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T279124 WP_000048134.1 NZ_CP123660:4173411-4173827 [Salmonella enterica subsp. enterica serovar Kentucky]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2T8L749 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SIC2 |