Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4083578..4084154 | Replicon | chromosome |
Accession | NZ_CP123660 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain CVM N38232 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | DE22_RS19670 | Protein ID | WP_001131963.1 |
Coordinates | 4083867..4084154 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A6C6ZAR7 |
Locus tag | DE22_RS19665 | Protein ID | WP_000063143.1 |
Coordinates | 4083578..4083880 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DE22_RS19650 (4080125) | 4080125..4082275 | + | 2151 | WP_000379929.1 | pyruvate/proton symporter BtsT | - |
DE22_RS19655 (4082333) | 4082333..4082536 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
DE22_RS19660 (4082547) | 4082547..4083503 | + | 957 | WP_000187838.1 | GTPase | - |
DE22_RS19665 (4083578) | 4083578..4083880 | - | 303 | WP_000063143.1 | BrnA antitoxin family protein | Antitoxin |
DE22_RS19670 (4083867) | 4083867..4084154 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
DE22_RS19675 (4084423) | 4084423..4085337 | - | 915 | WP_000290512.1 | restriction endonuclease | - |
DE22_RS19680 (4085535) | 4085535..4089044 | + | 3510 | WP_001043486.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T279123 WP_001131963.1 NZ_CP123660:c4084154-4083867 [Salmonella enterica subsp. enterica serovar Kentucky]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11402.01 Da Isoelectric Point: 10.1293
>AT279123 WP_000063143.1 NZ_CP123660:c4083880-4083578 [Salmonella enterica subsp. enterica serovar Kentucky]
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALVKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|