Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3460476..3461096 | Replicon | chromosome |
| Accession | NZ_CP123660 | ||
| Organism | Salmonella enterica subsp. enterica serovar Kentucky strain CVM N38232 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | DE22_RS16765 | Protein ID | WP_001280991.1 |
| Coordinates | 3460878..3461096 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | DE22_RS16760 | Protein ID | WP_000344807.1 |
| Coordinates | 3460476..3460850 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DE22_RS16750 (3455615) | 3455615..3456808 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| DE22_RS16755 (3456831) | 3456831..3459980 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| DE22_RS16760 (3460476) | 3460476..3460850 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| DE22_RS16765 (3460878) | 3460878..3461096 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| DE22_RS16770 (3461275) | 3461275..3461826 | + | 552 | WP_001278788.1 | maltose O-acetyltransferase | - |
| DE22_RS16775 (3461942) | 3461942..3462412 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| DE22_RS16780 (3462468) | 3462468..3462608 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| DE22_RS16785 (3462614) | 3462614..3462874 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| DE22_RS16790 (3463099) | 3463099..3464649 | + | 1551 | WP_000213144.1 | EAL domain-containing protein | - |
| DE22_RS16800 (3464880) | 3464880..3465269 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| DE22_RS16805 (3465302) | 3465302..3465871 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T279118 WP_001280991.1 NZ_CP123660:3460878-3461096 [Salmonella enterica subsp. enterica serovar Kentucky]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT279118 WP_000344807.1 NZ_CP123660:3460476-3460850 [Salmonella enterica subsp. enterica serovar Kentucky]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|