Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2437925..2438447 | Replicon | chromosome |
Accession | NZ_CP123660 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain CVM N38232 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | DE22_RS11775 | Protein ID | WP_000221345.1 |
Coordinates | 2438163..2438447 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | DE22_RS11770 | Protein ID | WP_000885424.1 |
Coordinates | 2437925..2438173 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DE22_RS11735 (2433107) | 2433107..2433442 | + | 336 | WP_001519747.1 | hypothetical protein | - |
DE22_RS11740 (2433752) | 2433752..2434015 | + | 264 | WP_129589477.1 | hypothetical protein | - |
DE22_RS11745 (2434279) | 2434279..2435208 | + | 930 | WP_001518895.1 | hypothetical protein | - |
DE22_RS11750 (2435547) | 2435547..2435879 | - | 333 | WP_000253156.1 | DUF1493 family protein | - |
DE22_RS11755 (2436295) | 2436295..2436402 | - | 108 | Protein_2297 | IS110 family transposase | - |
DE22_RS11760 (2436767) | 2436767..2437156 | + | 390 | WP_001044696.1 | hypothetical protein | - |
DE22_RS11765 (2437159) | 2437159..2437512 | + | 354 | WP_000418733.1 | hypothetical protein | - |
DE22_RS11770 (2437925) | 2437925..2438173 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
DE22_RS11775 (2438163) | 2438163..2438447 | + | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
DE22_RS11780 (2438618) | 2438618..2439007 | + | 390 | WP_000194089.1 | RidA family protein | - |
DE22_RS11785 (2439065) | 2439065..2440138 | - | 1074 | WP_000954681.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
DE22_RS11790 (2440331) | 2440331..2440819 | - | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
DE22_RS11795 (2440864) | 2440864..2442372 | + | 1509 | WP_000199403.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2425625..2445229 | 19604 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T279117 WP_000221345.1 NZ_CP123660:2438163-2438447 [Salmonella enterica subsp. enterica serovar Kentucky]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |