Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1030491..1031305 | Replicon | chromosome |
Accession | NZ_CP123660 | ||
Organism | Salmonella enterica subsp. enterica serovar Kentucky strain CVM N38232 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A3V9S344 |
Locus tag | DE22_RS04940 | Protein ID | WP_000971652.1 |
Coordinates | 1030491..1031018 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | DE22_RS04945 | Protein ID | WP_000855694.1 |
Coordinates | 1031015..1031305 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DE22_RS04910 (1026694) | 1026694..1027092 | + | 399 | Protein_961 | cytoplasmic protein | - |
DE22_RS04915 (1027303) | 1027303..1027521 | + | 219 | Protein_962 | hypothetical protein | - |
DE22_RS04920 (1027678) | 1027678..1028346 | + | 669 | WP_000445911.1 | hypothetical protein | - |
DE22_RS04925 (1028373) | 1028373..1028867 | + | 495 | WP_000424941.1 | hypothetical protein | - |
DE22_RS04930 (1029112) | 1029112..1029768 | - | 657 | WP_000420454.1 | protein-serine/threonine phosphatase | - |
DE22_RS04935 (1029995) | 1029995..1030418 | + | 424 | Protein_966 | transposase | - |
DE22_RS04940 (1030491) | 1030491..1031018 | - | 528 | WP_000971652.1 | GNAT family N-acetyltransferase | Toxin |
DE22_RS04945 (1031015) | 1031015..1031305 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
DE22_RS04950 (1031899) | 1031899..1032225 | + | 327 | WP_000393298.1 | hypothetical protein | - |
DE22_RS04955 (1032497) | 1032497..1032844 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
DE22_RS04960 (1032829) | 1032829..1033278 | - | 450 | WP_000381618.1 | hypothetical protein | - |
DE22_RS04965 (1033710) | 1033710..1034153 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
DE22_RS04970 (1034610) | 1034610..1035260 | + | 651 | WP_023166786.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1029112..1040573 | 11461 | |
- | flank | IS/Tn | - | - | 1030278..1030418 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19041.94 Da Isoelectric Point: 9.8881
>T279111 WP_000971652.1 NZ_CP123660:c1031018-1030491 [Salmonella enterica subsp. enterica serovar Kentucky]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRHDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLKDQPLSLLL
SFKTLYAALAASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRHDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLKDQPLSLLL
SFKTLYAALAASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT279111 WP_000855694.1 NZ_CP123660:c1031305-1031015 [Salmonella enterica subsp. enterica serovar Kentucky]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V9S344 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |