Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4820269..4820926 | Replicon | chromosome |
Accession | NZ_CP123642 | ||
Organism | Klebsiella pneumoniae strain KpBSB53 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | QFW99_RS24235 | Protein ID | WP_002916310.1 |
Coordinates | 4820516..4820926 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | QFW99_RS24230 | Protein ID | WP_002916312.1 |
Coordinates | 4820269..4820535 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFW99_RS24205 (4815477) | 4815477..4816910 | - | 1434 | WP_004185559.1 | 6-phospho-beta-glucosidase BglA | - |
QFW99_RS24210 (4817029) | 4817029..4817757 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
QFW99_RS24215 (4817807) | 4817807..4818118 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
QFW99_RS24220 (4818282) | 4818282..4818941 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
QFW99_RS24225 (4819040) | 4819040..4820023 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
QFW99_RS24230 (4820269) | 4820269..4820535 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
QFW99_RS24235 (4820516) | 4820516..4820926 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
QFW99_RS24240 (4820933) | 4820933..4821454 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
QFW99_RS24245 (4821555) | 4821555..4822451 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
QFW99_RS24250 (4822474) | 4822474..4823187 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QFW99_RS24255 (4823193) | 4823193..4824926 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T279109 WP_002916310.1 NZ_CP123642:4820516-4820926 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |