Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 3961802..3962427 | Replicon | chromosome |
| Accession | NZ_CP123642 | ||
| Organism | Klebsiella pneumoniae strain KpBSB53 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | QFW99_RS20005 | Protein ID | WP_002882817.1 |
| Coordinates | 3961802..3962185 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QFW99_RS20010 | Protein ID | WP_162557435.1 |
| Coordinates | 3962185..3962427 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFW99_RS19990 (3959168) | 3959168..3960070 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| QFW99_RS19995 (3960067) | 3960067..3960702 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QFW99_RS20000 (3960699) | 3960699..3961628 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| QFW99_RS20005 (3961802) | 3961802..3962185 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QFW99_RS20010 (3962185) | 3962185..3962427 | - | 243 | WP_162557435.1 | CopG family transcriptional regulator | Antitoxin |
| QFW99_RS20015 (3962632) | 3962632..3963549 | + | 918 | WP_032417884.1 | alpha/beta hydrolase | - |
| QFW99_RS20020 (3963564) | 3963564..3964505 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| QFW99_RS20025 (3964550) | 3964550..3964987 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| QFW99_RS20030 (3964984) | 3964984..3965844 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
| QFW99_RS20035 (3965838) | 3965838..3966437 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T279106 WP_002882817.1 NZ_CP123642:c3962185-3961802 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|