Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3488745..3489261 | Replicon | chromosome |
| Accession | NZ_CP123642 | ||
| Organism | Klebsiella pneumoniae strain KpBSB53 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A085DK79 |
| Locus tag | QFW99_RS17750 | Protein ID | WP_009309309.1 |
| Coordinates | 3488745..3489029 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | QFW99_RS17755 | Protein ID | WP_002886901.1 |
| Coordinates | 3489019..3489261 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFW99_RS17725 (3484228) | 3484228..3484536 | - | 309 | WP_019725542.1 | PTS sugar transporter subunit IIB | - |
| QFW99_RS17730 (3484621) | 3484621..3484794 | + | 174 | WP_019725541.1 | hypothetical protein | - |
| QFW99_RS17735 (3484797) | 3484797..3485540 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| QFW99_RS17740 (3485897) | 3485897..3488035 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QFW99_RS17745 (3488277) | 3488277..3488741 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QFW99_RS17750 (3488745) | 3488745..3489029 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFW99_RS17755 (3489019) | 3489019..3489261 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QFW99_RS17760 (3489339) | 3489339..3491249 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| QFW99_RS17765 (3491272) | 3491272..3492426 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| QFW99_RS17770 (3492493) | 3492493..3493233 | - | 741 | WP_032417761.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T279104 WP_009309309.1 NZ_CP123642:c3489029-3488745 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085DK79 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |