Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 3403455..3404158 | Replicon | chromosome |
Accession | NZ_CP123642 | ||
Organism | Klebsiella pneumoniae strain KpBSB53 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | QFW99_RS17375 | Protein ID | WP_017880111.1 |
Coordinates | 3403455..3403796 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | QFW99_RS17380 | Protein ID | WP_050131139.1 |
Coordinates | 3403817..3404158 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFW99_RS17345 (3398650) | 3398650..3399324 | + | 675 | WP_004186809.1 | hypothetical protein | - |
QFW99_RS17350 (3399326) | 3399326..3399673 | + | 348 | WP_004186808.1 | hypothetical protein | - |
QFW99_RS17355 (3399676) | 3399676..3400155 | + | 480 | WP_004192264.1 | type VI secretion system tube protein TssD | - |
QFW99_RS17360 (3400348) | 3400348..3400686 | - | 339 | Protein_3265 | hypothetical protein | - |
QFW99_RS17365 (3400705) | 3400705..3401816 | - | 1112 | Protein_3266 | IS3 family transposase | - |
QFW99_RS17370 (3402184) | 3402184..3403191 | - | 1008 | WP_017880110.1 | restriction endonuclease | - |
QFW99_RS17375 (3403455) | 3403455..3403796 | - | 342 | WP_017880111.1 | TA system toxin CbtA family protein | Toxin |
QFW99_RS17380 (3403817) | 3403817..3404158 | - | 342 | WP_050131139.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QFW99_RS17385 (3404169) | 3404169..3404711 | - | 543 | WP_032417798.1 | DNA repair protein RadC | - |
QFW99_RS17390 (3404724) | 3404724..3405167 | - | 444 | WP_032417797.1 | antirestriction protein | - |
QFW99_RS17395 (3405198) | 3405198..3406019 | - | 822 | WP_032417795.1 | DUF932 domain-containing protein | - |
QFW99_RS17400 (3406140) | 3406140..3406613 | - | 474 | WP_031280324.1 | hypothetical protein | - |
QFW99_RS17405 (3406685) | 3406685..3407137 | - | 453 | WP_031280325.1 | hypothetical protein | - |
QFW99_RS17410 (3407173) | 3407173..3407889 | - | 717 | WP_032417794.1 | WYL domain-containing protein | - |
QFW99_RS17415 (3408133) | 3408133..3409008 | - | 876 | WP_017880120.1 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3399326..3430664 | 31338 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12811.73 Da Isoelectric Point: 8.4941
>T279103 WP_017880111.1 NZ_CP123642:c3403796-3403455 [Klebsiella pneumoniae]
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDIMRARQATGLLKRNRISAAR
MKTLPATNPQAATLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDIMRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|