Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2777865..2778484 | Replicon | chromosome |
| Accession | NZ_CP123642 | ||
| Organism | Klebsiella pneumoniae strain KpBSB53 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | QFW99_RS14380 | Protein ID | WP_002892050.1 |
| Coordinates | 2778266..2778484 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | QFW99_RS14375 | Protein ID | WP_002892066.1 |
| Coordinates | 2777865..2778239 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFW99_RS14365 (2773017) | 2773017..2774210 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QFW99_RS14370 (2774233) | 2774233..2777379 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| QFW99_RS14375 (2777865) | 2777865..2778239 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| QFW99_RS14380 (2778266) | 2778266..2778484 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| QFW99_RS14385 (2778643) | 2778643..2779209 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| QFW99_RS14390 (2779181) | 2779181..2779321 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| QFW99_RS14395 (2779342) | 2779342..2779812 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| QFW99_RS14400 (2779787) | 2779787..2781238 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| QFW99_RS14405 (2781339) | 2781339..2782037 | + | 699 | WP_032416783.1 | GNAT family protein | - |
| QFW99_RS14410 (2782034) | 2782034..2782174 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| QFW99_RS14415 (2782174) | 2782174..2782437 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T279101 WP_002892050.1 NZ_CP123642:2778266-2778484 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT279101 WP_002892066.1 NZ_CP123642:2777865-2778239 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |