Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2777865..2778484 Replicon chromosome
Accession NZ_CP123642
Organism Klebsiella pneumoniae strain KpBSB53

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag QFW99_RS14380 Protein ID WP_002892050.1
Coordinates 2778266..2778484 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag QFW99_RS14375 Protein ID WP_002892066.1
Coordinates 2777865..2778239 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFW99_RS14365 (2773017) 2773017..2774210 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
QFW99_RS14370 (2774233) 2774233..2777379 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
QFW99_RS14375 (2777865) 2777865..2778239 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
QFW99_RS14380 (2778266) 2778266..2778484 + 219 WP_002892050.1 HHA domain-containing protein Toxin
QFW99_RS14385 (2778643) 2778643..2779209 + 567 WP_002892030.1 maltose O-acetyltransferase -
QFW99_RS14390 (2779181) 2779181..2779321 - 141 WP_004147370.1 hypothetical protein -
QFW99_RS14395 (2779342) 2779342..2779812 + 471 WP_002892026.1 YlaC family protein -
QFW99_RS14400 (2779787) 2779787..2781238 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
QFW99_RS14405 (2781339) 2781339..2782037 + 699 WP_032416783.1 GNAT family protein -
QFW99_RS14410 (2782034) 2782034..2782174 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
QFW99_RS14415 (2782174) 2782174..2782437 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T279101 WP_002892050.1 NZ_CP123642:2778266-2778484 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT279101 WP_002892066.1 NZ_CP123642:2777865-2778239 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References