Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 23863..24599 | Replicon | plasmid unnamed |
| Accession | NZ_CP123641 | ||
| Organism | Klebsiella pneumoniae strain KpBSB53 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A8T5ZF70 |
| Locus tag | QFW99_RS00150 | Protein ID | WP_004187044.1 |
| Coordinates | 24117..24599 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | QFW99_RS00145 | Protein ID | WP_003026799.1 |
| Coordinates | 23863..24129 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFW99_RS00125 (QFW99_00125) | 19012..19992 | + | 981 | Protein_24 | IS5-like element ISKpn26 family transposase | - |
| QFW99_RS00130 (QFW99_00130) | 20050..20295 | + | 246 | WP_032238678.1 | hypothetical protein | - |
| QFW99_RS00135 (QFW99_00135) | 20264..22849 | + | 2586 | WP_004187040.1 | EAL domain-containing protein | - |
| QFW99_RS00140 (QFW99_00140) | 23008..23712 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| QFW99_RS00145 (QFW99_00145) | 23863..24129 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| QFW99_RS00150 (QFW99_00150) | 24117..24599 | + | 483 | WP_004187044.1 | GNAT family N-acetyltransferase | Toxin |
| QFW99_RS00155 (QFW99_00155) | 24807..26153 | + | 1347 | WP_077250283.1 | ISNCY family transposase | - |
| QFW99_RS00160 (QFW99_00160) | 26212..27006 | + | 795 | WP_004187050.1 | tetratricopeptide repeat protein | - |
| QFW99_RS00165 (QFW99_00165) | 27045..28586 | - | 1542 | WP_172884608.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..142324 | 142324 | |
| - | inside | IScluster/Tn | - | - | 19012..26153 | 7141 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17280.93 Da Isoelectric Point: 8.7197
>T279095 WP_004187044.1 NZ_CP123641:24117-24599 [Klebsiella pneumoniae]
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
VGCITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTYERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|