Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 10446..10968 | Replicon | plasmid unnamed |
| Accession | NZ_CP123641 | ||
| Organism | Klebsiella pneumoniae strain KpBSB53 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A9J6S4Z8 |
| Locus tag | QFW99_RS00055 | Protein ID | WP_004187019.1 |
| Coordinates | 10446..10730 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4ZSR4 |
| Locus tag | QFW99_RS00060 | Protein ID | WP_004187025.1 |
| Coordinates | 10720..10968 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFW99_RS00035 (QFW99_00035) | 5665..6129 | - | 465 | WP_004187010.1 | conjugative transfer protein MobI(A/C) | - |
| QFW99_RS00040 (QFW99_00040) | 7672..8085 | + | 414 | WP_004187013.1 | hypothetical protein | - |
| QFW99_RS00045 (QFW99_00045) | 8742..8993 | + | 252 | Protein_8 | conjugal transfer protein TraH | - |
| QFW99_RS00050 (QFW99_00050) | 9075..10430 | + | 1356 | WP_004187017.1 | ISNCY family transposase | - |
| QFW99_RS00055 (QFW99_00055) | 10446..10730 | - | 285 | WP_004187019.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFW99_RS00060 (QFW99_00060) | 10720..10968 | - | 249 | WP_004187025.1 | plasmid stabilization protein | Antitoxin |
| QFW99_RS00065 (QFW99_00065) | 11258..11682 | - | 425 | Protein_12 | IS1 family transposase | - |
| QFW99_RS00070 (QFW99_00070) | 11870..11986 | - | 117 | Protein_13 | transposase domain-containing protein | - |
| QFW99_RS00075 (QFW99_00075) | 11931..12194 | - | 264 | WP_004187027.1 | transposase | - |
| QFW99_RS00080 (QFW99_00080) | 12209..12472 | + | 264 | WP_004118208.1 | hypothetical protein | - |
| QFW99_RS00085 (QFW99_00085) | 12716..12997 | + | 282 | WP_013307885.1 | helix-turn-helix domain-containing protein | - |
| QFW99_RS00090 (QFW99_00090) | 13032..13601 | + | 570 | WP_004152117.1 | small heat shock protein sHSP20 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..142324 | 142324 | |
| - | flank | IS/Tn | - | - | 11222..11488 | 266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11003.72 Da Isoelectric Point: 10.5388
>T279094 WP_004187019.1 NZ_CP123641:c10730-10446 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTLQVQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
MTYKLAFNESALKEWKKLGHTLQVQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNATLNRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|