Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 1679723..1680364 | Replicon | chromosome |
| Accession | NZ_CP123618 | ||
| Organism | Pasteurella multocida strain 19BRD-057 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QFH15_RS08380 | Protein ID | WP_277883190.1 |
| Coordinates | 1680185..1680364 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QFH15_RS08375 | Protein ID | WP_108511501.1 |
| Coordinates | 1679723..1680139 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFH15_RS08325 (QFH15_08325) | 1675231..1675656 | + | 426 | WP_223131940.1 | recombination protein NinB | - |
| QFH15_RS08330 (QFH15_08330) | 1676178..1676333 | + | 156 | WP_155736201.1 | hypothetical protein | - |
| QFH15_RS08335 (QFH15_08335) | 1676633..1676839 | + | 207 | WP_064965023.1 | hypothetical protein | - |
| QFH15_RS08340 (QFH15_08340) | 1676865..1677461 | + | 597 | WP_223131915.1 | recombination protein NinG | - |
| QFH15_RS08345 (QFH15_08345) | 1677463..1677924 | + | 462 | WP_014391474.1 | antiterminator Q family protein | - |
| QFH15_RS08355 (QFH15_08355) | 1678251..1678616 | + | 366 | WP_223131916.1 | phage holin, lambda family | - |
| QFH15_RS08360 (QFH15_08360) | 1678588..1679172 | + | 585 | WP_223131917.1 | glycoside hydrolase family 19 protein | - |
| QFH15_RS08365 (QFH15_08365) | 1679175..1679498 | + | 324 | WP_223131941.1 | DUF2570 family protein | - |
| QFH15_RS08370 (QFH15_08370) | 1679512..1679685 | + | 174 | WP_227718007.1 | lytic protein Rz1 | - |
| QFH15_RS08375 (QFH15_08375) | 1679723..1680139 | - | 417 | WP_108511501.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QFH15_RS08380 (QFH15_08380) | 1680185..1680364 | - | 180 | WP_277883190.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QFH15_RS08385 (QFH15_08385) | 1680620..1681096 | + | 477 | WP_075269225.1 | DUF1441 family protein | - |
| QFH15_RS08390 (QFH15_08390) | 1681099..1683207 | + | 2109 | WP_223131943.1 | phage terminase large subunit family protein | - |
| QFH15_RS08395 (QFH15_08395) | 1683204..1683425 | + | 222 | WP_014391481.1 | hypothetical protein | - |
| QFH15_RS08400 (QFH15_08400) | 1683422..1684960 | + | 1539 | WP_223131944.1 | phage portal protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1657032..1707659 | 50627 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6675.86 Da Isoelectric Point: 10.8207
>T279092 WP_277883190.1 NZ_CP123618:c1680364-1680185 [Pasteurella multocida]
MMKQSEFLRWLKAQGVETKEGSNHIKLYLNGKQSALPRHPSKEIAKGTEIAVKKQLGLK
MMKQSEFLRWLKAQGVETKEGSNHIKLYLNGKQSALPRHPSKEIAKGTEIAVKKQLGLK
Download Length: 180 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15553.84 Da Isoelectric Point: 4.5390
>AT279092 WP_108511501.1 NZ_CP123618:c1680139-1679723 [Pasteurella multocida]
MLYPAKFDKEDNGLYAVSFRDIPEALTCGDNFDDAVAMAKDALITSMDFYFEDFRKVPLPSEAKQDEVLIELPDSVFAKV
LLLNEMVEQNISNAELARRINVRPQEMQRITNISHSTKIDTISRALSALGKKLQLSVV
MLYPAKFDKEDNGLYAVSFRDIPEALTCGDNFDDAVAMAKDALITSMDFYFEDFRKVPLPSEAKQDEVLIELPDSVFAKV
LLLNEMVEQNISNAELARRINVRPQEMQRITNISHSTKIDTISRALSALGKKLQLSVV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|