Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-PumB/upstrm_HI1419-dnstrm_HI1420
Location 1669738..1670339 Replicon chromosome
Accession NZ_CP123618
Organism Pasteurella multocida strain 19BRD-057

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QFH15_RS08285 Protein ID WP_223131907.1
Coordinates 1669738..1670052 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID -
Locus tag QFH15_RS08290 Protein ID WP_223131908.1
Coordinates 1670049..1670339 (+) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFH15_RS08235 (QFH15_08235) 1665470..1665631 - 162 WP_014390707.1 hypothetical protein -
QFH15_RS08240 (QFH15_08240) 1665645..1665881 - 237 WP_016570068.1 hypothetical protein -
QFH15_RS08245 (QFH15_08245) 1665868..1666152 - 285 WP_016570069.1 hypothetical protein -
QFH15_RS08250 (QFH15_08250) 1666300..1666530 + 231 WP_223251317.1 hypothetical protein -
QFH15_RS08255 (QFH15_08255) 1666592..1667227 - 636 WP_016569990.1 Bro-N domain-containing protein -
QFH15_RS08260 (QFH15_08260) 1667604..1668014 + 411 WP_115173413.1 hypothetical protein -
QFH15_RS08270 (QFH15_08270) 1668625..1668798 + 174 WP_167409471.1 hypothetical protein -
QFH15_RS08275 (QFH15_08275) 1668785..1669024 - 240 WP_223131905.1 hypothetical protein -
QFH15_RS08280 (QFH15_08280) 1669050..1669277 - 228 WP_223131906.1 hypothetical protein -
QFH15_RS08285 (QFH15_08285) 1669738..1670052 + 315 WP_223131907.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QFH15_RS08290 (QFH15_08290) 1670049..1670339 + 291 WP_223131908.1 putative addiction module antidote protein Antitoxin
QFH15_RS08295 (QFH15_08295) 1670382..1671014 - 633 WP_223131909.1 S24 family peptidase -
QFH15_RS08300 (QFH15_08300) 1671152..1671358 + 207 WP_064965013.1 helix-turn-helix transcriptional regulator -
QFH15_RS08305 (QFH15_08305) 1671407..1671856 + 450 WP_223131910.1 YmfL family putative regulatory protein -
QFH15_RS08310 (QFH15_08310) 1671914..1672597 + 684 WP_223131911.1 phage antirepressor KilAC domain-containing protein -
QFH15_RS08315 (QFH15_08315) 1672682..1673791 + 1110 WP_262495050.1 hypothetical protein -
QFH15_RS08320 (QFH15_08320) 1673791..1675227 + 1437 WP_223131912.1 DnaB-like helicase C-terminal domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1657032..1707659 50627


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-88)

Antitoxin

Cro/C1-type helix-turn-helix domain

(47-91)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11837.74 Da        Isoelectric Point: 9.7597

>T279091 WP_223131907.1 NZ_CP123618:1669738-1670052 [Pasteurella multocida]
MFELIETTVFNKWLKELKDLSAKAAILARINRAKNGNFGDHKSVGDGLYEMRIMKGAGYRVYYTQYKDVTYLLICGGDKS
TQKADIAKAKVLWEEIKQKEGVNV

Download         Length: 315 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10560.20 Da        Isoelectric Point: 5.7134

>AT279091 WP_223131908.1 NZ_CP123618:1670049-1670339 [Pasteurella multocida]
MSKKVELKPFDIAEHLDSEEMIAAYLSEVLETGDTNEFISALGDVARARGMTELAAKTGLGRESLYKTLSYGSKPRFDTI
MKITQALGIKLVPTHI

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References