Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3782545..3783166 Replicon chromosome
Accession NZ_CP123607
Organism Serratia marcescens strain RMCH-M16-N

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag QFB85_RS18080 Protein ID WP_004940313.1
Coordinates 3782963..3783166 (+) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag QFB85_RS18075 Protein ID WP_004940312.1
Coordinates 3782545..3782913 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFB85_RS18045 (QFB85_18045) 3778642..3778896 + 255 WP_004940303.1 type B 50S ribosomal protein L31 -
QFB85_RS18050 (QFB85_18050) 3778909..3779049 + 141 WP_004940304.1 type B 50S ribosomal protein L36 -
QFB85_RS18055 (QFB85_18055) 3779157..3780035 - 879 WP_280630871.1 metal ABC transporter substrate-binding protein -
QFB85_RS18060 (QFB85_18060) 3780061..3780918 - 858 WP_280630872.1 metal ABC transporter permease -
QFB85_RS18065 (QFB85_18065) 3780915..3781629 - 715 Protein_3535 ABC transporter ATP-binding protein -
QFB85_RS18070 (QFB85_18070) 3782033..3782386 + 354 WP_004940311.1 hypothetical protein -
QFB85_RS18075 (QFB85_18075) 3782545..3782913 + 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
QFB85_RS18080 (QFB85_18080) 3782963..3783166 + 204 WP_004940313.1 HHA domain-containing protein Toxin
QFB85_RS18090 (QFB85_18090) 3783750..3784064 + 315 WP_015376856.1 MGMT family protein -
QFB85_RS18095 (QFB85_18095) 3784129..3784620 - 492 WP_016928846.1 YbaY family lipoprotein -
QFB85_RS18100 (QFB85_18100) 3784852..3785715 + 864 WP_004940320.1 acyl-CoA thioesterase II -
QFB85_RS18105 (QFB85_18105) 3785806..3787092 - 1287 WP_004940322.1 ammonium transporter AmtB -
QFB85_RS18110 (QFB85_18110) 3787129..3787467 - 339 WP_004940327.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T279089 WP_004940313.1 NZ_CP123607:3782963-3783166 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT279089 WP_004940312.1 NZ_CP123607:3782545-3782913 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References