Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1078196..1078852 | Replicon | chromosome |
Accession | NZ_CP123607 | ||
Organism | Serratia marcescens strain RMCH-M16-N |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QFB85_RS05040 | Protein ID | WP_021504433.1 |
Coordinates | 1078463..1078852 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A8G2LCA8 |
Locus tag | QFB85_RS05035 | Protein ID | WP_004941563.1 |
Coordinates | 1078196..1078459 (+) | Length | 88 a.a. |
Genomic Context
Location: 1078196..1078459 (264 bp)
Type: Antitoxin
Protein ID: WP_004941563.1
Type: Antitoxin
Protein ID: WP_004941563.1
Location: 1078463..1078852 (390 bp)
Type: Toxin
Protein ID: WP_021504433.1
Type: Toxin
Protein ID: WP_021504433.1
Location: 1073234..1074448 (1215 bp)
Type: Others
Protein ID: WP_015378743.1
Type: Others
Protein ID: WP_015378743.1
Location: 1074617..1075522 (906 bp)
Type: Others
Protein ID: WP_280631311.1
Type: Others
Protein ID: WP_280631311.1
Location: 1075989..1077341 (1353 bp)
Type: Others
Protein ID: WP_280631312.1
Type: Others
Protein ID: WP_280631312.1
Location: 1077520..1077858 (339 bp)
Type: Others
Protein ID: WP_004941561.1
Type: Others
Protein ID: WP_004941561.1
Location: 1078860..1079576 (717 bp)
Type: Others
Protein ID: WP_197753782.1
Type: Others
Protein ID: WP_197753782.1
Location: 1079576..1080958 (1383 bp)
Type: Others
Protein ID: WP_021504432.1
Type: Others
Protein ID: WP_021504432.1
Location: 1080955..1082385 (1431 bp)
Type: Others
Protein ID: WP_280631313.1
Type: Others
Protein ID: WP_280631313.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB85_RS05015 (QFB85_05015) | 1073234..1074448 | - | 1215 | WP_015378743.1 | D-galactonate dehydratase family protein | - |
QFB85_RS05020 (QFB85_05020) | 1074617..1075522 | - | 906 | WP_280631311.1 | lipid kinase YegS | - |
QFB85_RS05025 (QFB85_05025) | 1075989..1077341 | - | 1353 | WP_280631312.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
QFB85_RS05030 (QFB85_05030) | 1077520..1077858 | - | 339 | WP_004941561.1 | YegP family protein | - |
QFB85_RS05035 (QFB85_05035) | 1078196..1078459 | + | 264 | WP_004941563.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QFB85_RS05040 (QFB85_05040) | 1078463..1078852 | + | 390 | WP_021504433.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QFB85_RS05045 (QFB85_05045) | 1078860..1079576 | - | 717 | WP_197753782.1 | two-component system response regulator BaeR | - |
QFB85_RS05050 (QFB85_05050) | 1079576..1080958 | - | 1383 | WP_021504432.1 | two-component system sensor histidine kinase BaeS | - |
QFB85_RS05055 (QFB85_05055) | 1080955..1082385 | - | 1431 | WP_280631313.1 | multidrug transporter subunit MdtD | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14398.63 Da Isoelectric Point: 8.4983
>T279083 WP_021504433.1 NZ_CP123607:1078463-1078852 [Serratia marcescens]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQSMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp