Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 732096..732765 | Replicon | chromosome |
Accession | NZ_CP123607 | ||
Organism | Serratia marcescens strain RMCH-M16-N |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | QFB85_RS03430 | Protein ID | WP_004931681.1 |
Coordinates | 732343..732765 (+) | Length | 141 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
Locus tag | QFB85_RS03425 | Protein ID | WP_004931679.1 |
Coordinates | 732096..732362 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB85_RS03400 (QFB85_03400) | 727408..728409 | - | 1002 | WP_280631232.1 | DUF4214 domain-containing protein | - |
QFB85_RS03405 (QFB85_03405) | 728629..729237 | - | 609 | WP_033632167.1 | HD domain-containing protein | - |
QFB85_RS03410 (QFB85_03410) | 729421..730095 | + | 675 | WP_021505704.1 | hemolysin III family protein | - |
QFB85_RS03415 (QFB85_03415) | 730246..730743 | + | 498 | WP_049186827.1 | DUF2165 domain-containing protein | - |
QFB85_RS03420 (QFB85_03420) | 730782..731774 | - | 993 | WP_280631233.1 | tRNA-modifying protein YgfZ | - |
QFB85_RS03425 (QFB85_03425) | 732096..732362 | + | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
QFB85_RS03430 (QFB85_03430) | 732343..732765 | + | 423 | WP_004931681.1 | protein YgfX | Toxin |
QFB85_RS03435 (QFB85_03435) | 732831..733349 | - | 519 | WP_280631234.1 | flavodoxin FldB | - |
QFB85_RS03440 (QFB85_03440) | 733456..734355 | + | 900 | WP_004931685.1 | site-specific tyrosine recombinase XerD | - |
QFB85_RS03445 (QFB85_03445) | 734382..735098 | + | 717 | WP_004931688.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QFB85_RS03450 (QFB85_03450) | 735105..736838 | + | 1734 | WP_004931690.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16487.59 Da Isoelectric Point: 11.0198
>T279081 WP_004931681.1 NZ_CP123607:732343-732765 [Serratia marcescens]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEQG
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEQG
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|