Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 9559..10295 | Replicon | plasmid unnamed2 |
Accession | NZ_CP123600 | ||
Organism | Enterobacter cloacae strain RMCH-M23-N |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | QFB83_RS24420 | Protein ID | WP_003026803.1 |
Coordinates | 9813..10295 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | QFB83_RS24415 | Protein ID | WP_003026799.1 |
Coordinates | 9559..9825 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB83_RS24390 (QFB83_24390) | 4642..5652 | + | 1011 | WP_000200070.1 | RepB family plasmid replication initiator protein | - |
QFB83_RS24395 (QFB83_24395) | 6350..7090 | - | 741 | WP_001515717.1 | tyrosine-type recombinase/integrase | - |
QFB83_RS24400 (QFB83_24400) | 7454..8422 | - | 969 | WP_023307223.1 | IS5-like element IS903B family transposase | - |
QFB83_RS24405 (QFB83_24405) | 8667..8870 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
QFB83_RS24410 (QFB83_24410) | 8884..9114 | + | 231 | WP_023307222.1 | hypothetical protein | - |
QFB83_RS24415 (QFB83_24415) | 9559..9825 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
QFB83_RS24420 (QFB83_24420) | 9813..10295 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
QFB83_RS24425 (QFB83_24425) | 10474..11877 | + | 1404 | WP_004113090.1 | ISNCY family transposase | - |
QFB83_RS24430 (QFB83_24430) | 11908..12825 | - | 918 | WP_158003452.1 | S-4TM family putative pore-forming effector | - |
QFB83_RS24435 (QFB83_24435) | 12829..13827 | - | 999 | WP_001610306.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | mrkJ / mrkF / mrkD / mrkC / mrkB / mrkA | 1..84591 | 84591 | |
- | inside | IScluster/Tn | - | - | 7454..23730 | 16276 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T279079 WP_003026803.1 NZ_CP123600:9813-10295 [Enterobacter cloacae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |