Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2389340..2389960 | Replicon | chromosome |
Accession | NZ_CP123598 | ||
Organism | Enterobacter cloacae strain RMCH-M23-N |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A5E1A1U8 |
Locus tag | QFB83_RS11425 | Protein ID | WP_013095889.1 |
Coordinates | 2389340..2389558 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | QFB83_RS11430 | Protein ID | WP_008499288.1 |
Coordinates | 2389586..2389960 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB83_RS11395 (QFB83_11395) | 2385352..2385612 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
QFB83_RS11400 (QFB83_11400) | 2385615..2385755 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
QFB83_RS11405 (QFB83_11405) | 2385752..2386462 | - | 711 | WP_057071118.1 | GNAT family protein | - |
QFB83_RS11410 (QFB83_11410) | 2386564..2388024 | + | 1461 | WP_057071117.1 | PLP-dependent aminotransferase family protein | - |
QFB83_RS11415 (QFB83_11415) | 2387996..2388463 | - | 468 | WP_013095887.1 | YlaC family protein | - |
QFB83_RS11420 (QFB83_11420) | 2388579..2389130 | - | 552 | WP_013095888.1 | maltose O-acetyltransferase | - |
QFB83_RS11425 (QFB83_11425) | 2389340..2389558 | - | 219 | WP_013095889.1 | HHA domain-containing protein | Toxin |
QFB83_RS11430 (QFB83_11430) | 2389586..2389960 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
QFB83_RS11435 (QFB83_11435) | 2390473..2393619 | - | 3147 | WP_013095890.1 | multidrug efflux RND transporter permease subunit AcrB | - |
QFB83_RS11440 (QFB83_11440) | 2393642..2394835 | - | 1194 | WP_023620093.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8625.98 Da Isoelectric Point: 8.9008
>T279071 WP_013095889.1 NZ_CP123598:c2389558-2389340 [Enterobacter cloacae]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT279071 WP_008499288.1 NZ_CP123598:c2389960-2389586 [Enterobacter cloacae]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E1A1U8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |