Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 1857988..1858564 | Replicon | chromosome |
| Accession | NZ_CP123598 | ||
| Organism | Enterobacter cloacae strain RMCH-M23-N | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | QFB83_RS08980 | Protein ID | WP_280597388.1 |
| Coordinates | 1857988..1858275 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | QFB83_RS08985 | Protein ID | WP_057072722.1 |
| Coordinates | 1858262..1858564 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB83_RS08960 (QFB83_08960) | 1853950..1854420 | + | 471 | WP_013095432.1 | MarR family transcriptional regulator | - |
| QFB83_RS08965 (QFB83_08965) | 1854417..1855484 | + | 1068 | WP_100245169.1 | HlyD family secretion protein | - |
| QFB83_RS08970 (QFB83_08970) | 1855474..1856550 | + | 1077 | WP_013095434.1 | DUF2955 domain-containing protein | - |
| QFB83_RS08975 (QFB83_08975) | 1856520..1857818 | - | 1299 | WP_013095435.1 | DUF445 domain-containing protein | - |
| QFB83_RS08980 (QFB83_08980) | 1857988..1858275 | + | 288 | WP_280597388.1 | BrnT family toxin | Toxin |
| QFB83_RS08985 (QFB83_08985) | 1858262..1858564 | + | 303 | WP_057072722.1 | BrnA antitoxin family protein | Antitoxin |
| QFB83_RS08990 (QFB83_08990) | 1858595..1859233 | - | 639 | WP_129327048.1 | LysE family translocator | - |
| QFB83_RS08995 (QFB83_08995) | 1859282..1860025 | - | 744 | WP_057071674.1 | AraC family transcriptional regulator | - |
| QFB83_RS09000 (QFB83_09000) | 1860163..1861533 | + | 1371 | WP_038418628.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| QFB83_RS09005 (QFB83_09005) | 1861575..1861895 | - | 321 | WP_013095439.1 | hypothetical protein | - |
| QFB83_RS09010 (QFB83_09010) | 1861895..1862440 | - | 546 | WP_013095440.1 | YfaZ family outer membrane protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11233.60 Da Isoelectric Point: 6.8813
>T279070 WP_280597388.1 NZ_CP123598:1857988-1858275 [Enterobacter cloacae]
MPTEYEWDSDKAKSNQQKHGIRFEDAVLVFDDPYHLSVQDRYENGEFRWQTIGLVQGVIIILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
MPTEYEWDSDKAKSNQQKHGIRFEDAVLVFDDPYHLSVQDRYENGEFRWQTIGLVQGVIIILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|