Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1817051..1817567 | Replicon | chromosome |
Accession | NZ_CP123598 | ||
Organism | Enterobacter cloacae strain RMCH-M23-N |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QFB83_RS08800 | Protein ID | WP_045292395.1 |
Coordinates | 1817283..1817567 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V3EXX3 |
Locus tag | QFB83_RS08795 | Protein ID | WP_008501400.1 |
Coordinates | 1817051..1817293 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB83_RS08780 (QFB83_08780) | 1813040..1813780 | + | 741 | WP_057071447.1 | KDGP aldolase family protein | - |
QFB83_RS08785 (QFB83_08785) | 1813904..1815043 | + | 1140 | WP_100168201.1 | lactonase family protein | - |
QFB83_RS08790 (QFB83_08790) | 1815063..1816973 | + | 1911 | WP_280597354.1 | PRD domain-containing protein | - |
QFB83_RS08795 (QFB83_08795) | 1817051..1817293 | + | 243 | WP_008501400.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QFB83_RS08800 (QFB83_08800) | 1817283..1817567 | + | 285 | WP_045292395.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QFB83_RS08805 (QFB83_08805) | 1817571..1818035 | - | 465 | WP_057071444.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
QFB83_RS08810 (QFB83_08810) | 1818158..1820296 | - | 2139 | WP_013095357.1 | anaerobic ribonucleoside-triphosphate reductase | - |
QFB83_RS08815 (QFB83_08815) | 1820670..1822313 | - | 1644 | WP_280597359.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10945.83 Da Isoelectric Point: 10.4610
>T279069 WP_045292395.1 NZ_CP123598:1817283-1817567 [Enterobacter cloacae]
MTYELEFDPRALKEWSKLGETVKKQFRKKLAGVLVNPRIESARLHTLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGK
REKSAVYHDANKRL
MTYELEFDPRALKEWSKLGETVKKQFRKKLAGVLVNPRIESARLHTLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGK
REKSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|