Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 1592982..1593578 | Replicon | chromosome |
| Accession | NZ_CP123598 | ||
| Organism | Enterobacter cloacae strain RMCH-M23-N | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | QFB83_RS07695 | Protein ID | WP_058684023.1 |
| Coordinates | 1593276..1593578 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | QFB83_RS07690 | Protein ID | WP_057072139.1 |
| Coordinates | 1592982..1593269 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB83_RS07685 (QFB83_07685) | 1591354..1592985 | + | 1632 | WP_013095027.1 | Na/Pi cotransporter family protein | - |
| QFB83_RS07690 (QFB83_07690) | 1592982..1593269 | - | 288 | WP_057072139.1 | putative addiction module antidote protein | Antitoxin |
| QFB83_RS07695 (QFB83_07695) | 1593276..1593578 | - | 303 | WP_058684023.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QFB83_RS07700 (QFB83_07700) | 1593776..1594645 | + | 870 | WP_023621411.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| QFB83_RS07705 (QFB83_07705) | 1594713..1595657 | - | 945 | WP_013095031.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| QFB83_RS07710 (QFB83_07710) | 1595750..1597099 | - | 1350 | WP_013095032.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11517.34 Da Isoelectric Point: 9.9670
>T279068 WP_058684023.1 NZ_CP123598:c1593578-1593276 [Enterobacter cloacae]
MKEIVQTESFRRWEQNLKDRRARTIIASRLFRLANGLAGDIKPVGEGICELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRARTIIASRLFRLANGLAGDIKPVGEGICELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|