Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1486157..1486761 | Replicon | chromosome |
Accession | NZ_CP123598 | ||
Organism | Enterobacter cloacae strain RMCH-M23-N |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A421IJD5 |
Locus tag | QFB83_RS07220 | Protein ID | WP_071843252.1 |
Coordinates | 1486157..1486342 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A5E1AFC9 |
Locus tag | QFB83_RS07225 | Protein ID | WP_023621194.1 |
Coordinates | 1486357..1486761 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB83_RS07205 (QFB83_07205) | 1482588..1484126 | + | 1539 | WP_280597218.1 | aldehyde dehydrogenase family protein | - |
QFB83_RS07210 (QFB83_07210) | 1484123..1485088 | - | 966 | WP_061771396.1 | LysR family transcriptional regulator | - |
QFB83_RS07215 (QFB83_07215) | 1485206..1485946 | + | 741 | WP_013094942.1 | MipA/OmpV family protein | - |
QFB83_RS07220 (QFB83_07220) | 1486157..1486342 | + | 186 | WP_071843252.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
QFB83_RS07225 (QFB83_07225) | 1486357..1486761 | + | 405 | WP_023621194.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
QFB83_RS07230 (QFB83_07230) | 1486815..1488770 | - | 1956 | WP_062730039.1 | glycoside hydrolase family 127 protein | - |
QFB83_RS07235 (QFB83_07235) | 1488781..1490181 | - | 1401 | WP_057071744.1 | MFS transporter | - |
QFB83_RS07240 (QFB83_07240) | 1490406..1491224 | + | 819 | WP_020686525.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6859.08 Da Isoelectric Point: 11.7891
>T279067 WP_071843252.1 NZ_CP123598:1486157-1486342 [Enterobacter cloacae]
VKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14888.72 Da Isoelectric Point: 4.3036
>AT279067 WP_023621194.1 NZ_CP123598:1486357-1486761 [Enterobacter cloacae]
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVSEHPQFSNRSAFLAEAARRVLP
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVSEHPQFSNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A421IJD5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E1AFC9 |