Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 1353781..1354443 | Replicon | chromosome |
| Accession | NZ_CP123598 | ||
| Organism | Enterobacter cloacae strain RMCH-M23-N | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QFB83_RS06590 | Protein ID | WP_020686448.1 |
| Coordinates | 1354045..1354443 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A5E1AFU3 |
| Locus tag | QFB83_RS06585 | Protein ID | WP_020686447.1 |
| Coordinates | 1353781..1354041 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB83_RS06570 (QFB83_06570) | 1351207..1352328 | - | 1122 | WP_057072238.1 | efflux RND transporter periplasmic adaptor subunit | - |
| QFB83_RS06575 (QFB83_06575) | 1352477..1353046 | - | 570 | WP_013094828.1 | TetR/AcrR family transcriptional regulator | - |
| QFB83_RS06580 (QFB83_06580) | 1353234..1353653 | + | 420 | WP_038418282.1 | GNAT family N-acetyltransferase | - |
| QFB83_RS06585 (QFB83_06585) | 1353781..1354041 | + | 261 | WP_020686447.1 | virulence protein | Antitoxin |
| QFB83_RS06590 (QFB83_06590) | 1354045..1354443 | + | 399 | WP_020686448.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QFB83_RS06595 (QFB83_06595) | 1354584..1355384 | + | 801 | WP_029881865.1 | lipoprotein NlpA | - |
| QFB83_RS06600 (QFB83_06600) | 1355397..1356077 | - | 681 | WP_029881866.1 | EAL domain-containing protein | - |
| QFB83_RS06605 (QFB83_06605) | 1356146..1356757 | - | 612 | WP_013094832.1 | LuxR C-terminal-related transcriptional regulator | - |
| QFB83_RS06610 (QFB83_06610) | 1357205..1357870 | + | 666 | WP_020686451.1 | LuxR C-terminal-related transcriptional regulator | - |
| QFB83_RS06615 (QFB83_06615) | 1357912..1358976 | - | 1065 | WP_020686452.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14855.11 Da Isoelectric Point: 6.7510
>T279066 WP_020686448.1 NZ_CP123598:1354045-1354443 [Enterobacter cloacae]
MLHMLDTNIVSHLVRQHPGVIKHYSRTPIEKMCISSVTEAELLYGIAKKQSDRLQKTILEFLKTITICDWDSEAAATYGE
LRAEMEKRGRVMGDLDQLIAAHALSRGTTIVTNDHAFRMVQALAVEDWTTAS
MLHMLDTNIVSHLVRQHPGVIKHYSRTPIEKMCISSVTEAELLYGIAKKQSDRLQKTILEFLKTITICDWDSEAAATYGE
LRAEMEKRGRVMGDLDQLIAAHALSRGTTIVTNDHAFRMVQALAVEDWTTAS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|