Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 501279..501958 | Replicon | chromosome |
Accession | NZ_CP123598 | ||
Organism | Enterobacter cloacae strain RMCH-M23-N |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A7I6XXA8 |
Locus tag | QFB83_RS02455 | Protein ID | WP_039025449.1 |
Coordinates | 501279..501620 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | - |
Locus tag | QFB83_RS02460 | Protein ID | WP_280596645.1 |
Coordinates | 501641..501958 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB83_RS02435 (QFB83_02435) | 496550..498295 | + | 1746 | WP_014833324.1 | DNA primase | - |
QFB83_RS02440 (QFB83_02440) | 498461..500308 | + | 1848 | WP_013098777.1 | RNA polymerase sigma factor RpoD | - |
QFB83_RS02445 (QFB83_02445) | 500410..500916 | - | 507 | WP_020689452.1 | G/U mismatch-specific DNA glycosylase | - |
QFB83_RS02455 (QFB83_02455) | 501279..501620 | - | 342 | WP_039025449.1 | TA system toxin CbtA family protein | Toxin |
QFB83_RS02460 (QFB83_02460) | 501641..501958 | - | 318 | WP_280596645.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
QFB83_RS02465 (QFB83_02465) | 501977..502198 | - | 222 | WP_039025447.1 | DUF987 domain-containing protein | - |
QFB83_RS02470 (QFB83_02470) | 502207..502350 | - | 144 | Protein_476 | JAB domain-containing protein | - |
QFB83_RS02475 (QFB83_02475) | 502390..502848 | - | 459 | WP_039025446.1 | antirestriction protein | - |
QFB83_RS02480 (QFB83_02480) | 502950..503189 | - | 240 | WP_039025445.1 | DUF905 domain-containing protein | - |
QFB83_RS02485 (QFB83_02485) | 503266..503733 | - | 468 | WP_039025444.1 | protein YkfB | - |
QFB83_RS02490 (QFB83_02490) | 503756..504199 | - | 444 | WP_039025443.1 | hypothetical protein | - |
QFB83_RS02495 (QFB83_02495) | 504199..504435 | - | 237 | WP_001115854.1 | protein YpjK | - |
QFB83_RS02500 (QFB83_02500) | 504472..505173 | - | 702 | WP_280596648.1 | WYL domain-containing protein | - |
QFB83_RS02505 (QFB83_02505) | 505390..506211 | - | 822 | WP_039025441.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12880.79 Da Isoelectric Point: 9.6548
>T279064 WP_039025449.1 NZ_CP123598:c501620-501279 [Enterobacter cloacae]
MNTLPATTQRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFSDETVIREHINAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNSVQ
MNTLPATTQRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFSDETVIREHINAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNSVQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|