Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 315253..315913 | Replicon | chromosome |
Accession | NZ_CP123598 | ||
Organism | Enterobacter cloacae strain RMCH-M23-N |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A5E1AGQ2 |
Locus tag | QFB83_RS01575 | Protein ID | WP_023620447.1 |
Coordinates | 315253..315666 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | A0A5E1AG01 |
Locus tag | QFB83_RS01580 | Protein ID | WP_013098615.1 |
Coordinates | 315647..315913 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB83_RS01555 (QFB83_01555) | 311246..312979 | - | 1734 | WP_280596520.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QFB83_RS01560 (QFB83_01560) | 312985..313698 | - | 714 | WP_013098611.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QFB83_RS01565 (QFB83_01565) | 313727..314623 | - | 897 | WP_013098612.1 | site-specific tyrosine recombinase XerD | - |
QFB83_RS01570 (QFB83_01570) | 314725..315246 | + | 522 | WP_013098613.1 | flavodoxin FldB | - |
QFB83_RS01575 (QFB83_01575) | 315253..315666 | - | 414 | WP_023620447.1 | protein YgfX | Toxin |
QFB83_RS01580 (QFB83_01580) | 315647..315913 | - | 267 | WP_013098615.1 | FAD assembly factor SdhE | Antitoxin |
QFB83_RS01585 (QFB83_01585) | 316208..317188 | + | 981 | WP_023620448.1 | tRNA-modifying protein YgfZ | - |
QFB83_RS01590 (QFB83_01590) | 317298..317957 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
QFB83_RS01595 (QFB83_01595) | 318223..318954 | + | 732 | WP_020687085.1 | MurR/RpiR family transcriptional regulator | - |
QFB83_RS01600 (QFB83_01600) | 319070..320503 | + | 1434 | WP_020687084.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16220.21 Da Isoelectric Point: 10.9554
>T279063 WP_023620447.1 NZ_CP123598:c315666-315253 [Enterobacter cloacae]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLSSGMMLRLRQVGGGKCQHLWLAADSMDIAEWRELRRMLLQQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLSSGMMLRLRQVGGGKCQHLWLAADSMDIAEWRELRRMLLQQQPTQE
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E1AGQ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5E1AG01 |