Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3413344..3414013 | Replicon | chromosome |
| Accession | NZ_CP123597 | ||
| Organism | Serratia marcescens strain RMCH-M26-N | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0P0QIF8 |
| Locus tag | QFB82_RS16475 | Protein ID | WP_033632171.1 |
| Coordinates | 3413344..3413766 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A8G2G4M4 |
| Locus tag | QFB82_RS16480 | Protein ID | WP_004931679.1 |
| Coordinates | 3413747..3414013 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB82_RS16455 (QFB82_16455) | 3409236..3409754 | + | 519 | WP_004931683.1 | flavodoxin FldB | - |
| QFB82_RS16460 (QFB82_16460) | 3409789..3411153 | - | 1365 | WP_085337104.1 | cell envelope integrity protein CreD | - |
| QFB82_RS16465 (QFB82_16465) | 3411234..3412652 | - | 1419 | WP_033632173.1 | two-component system sensor histidine kinase CreC | - |
| QFB82_RS16470 (QFB82_16470) | 3412649..3413344 | - | 696 | WP_033632172.1 | two-component system response regulator CreB | - |
| QFB82_RS16475 (QFB82_16475) | 3413344..3413766 | - | 423 | WP_033632171.1 | protein YgfX | Toxin |
| QFB82_RS16480 (QFB82_16480) | 3413747..3414013 | - | 267 | WP_004931679.1 | FAD assembly factor SdhE | Antitoxin |
| QFB82_RS16485 (QFB82_16485) | 3414335..3415327 | + | 993 | WP_103086252.1 | tRNA-modifying protein YgfZ | - |
| QFB82_RS16490 (QFB82_16490) | 3415366..3415863 | - | 498 | WP_280597683.1 | DUF2165 domain-containing protein | - |
| QFB82_RS16495 (QFB82_16495) | 3416014..3416688 | - | 675 | WP_033632168.1 | hemolysin III family protein | - |
| QFB82_RS16500 (QFB82_16500) | 3416872..3417480 | + | 609 | WP_004931670.1 | HD domain-containing protein | - |
| QFB82_RS16505 (QFB82_16505) | 3417521..3418447 | - | 927 | WP_015378971.1 | ribokinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16518.60 Da Isoelectric Point: 10.8114
>T279059 WP_033632171.1 NZ_CP123597:c3413766-3413344 [Serratia marcescens]
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEES
VAQWRCDIRISWRTQLFSLLTHGVLILLILISPWPEGFGPLWLVLLTLVVFQCIRSQKRIAAVQGELRLLADRRFSWHGR
EWRLAKKPWMPGYGMLLTLQPMEGKKRRRLWLASDCMSKEEWRHLRQLLLYPPAGDGEES
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|