Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3019818..3020474 | Replicon | chromosome |
Accession | NZ_CP123597 | ||
Organism | Serratia marcescens strain RMCH-M26-N |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QFB82_RS14650 | Protein ID | WP_049239890.1 |
Coordinates | 3019818..3020207 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QFB82_RS14655 | Protein ID | WP_164096894.1 |
Coordinates | 3020211..3020474 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QFB82_RS14635 (QFB82_14635) | 3016285..3017715 | + | 1431 | WP_213929626.1 | multidrug transporter subunit MdtD | - |
QFB82_RS14640 (QFB82_14640) | 3017712..3019094 | + | 1383 | WP_016926705.1 | two-component system sensor histidine kinase BaeS | - |
QFB82_RS14645 (QFB82_14645) | 3019094..3019810 | + | 717 | WP_004941568.1 | two-component system response regulator BaeR | - |
QFB82_RS14650 (QFB82_14650) | 3019818..3020207 | - | 390 | WP_049239890.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QFB82_RS14655 (QFB82_14655) | 3020211..3020474 | - | 264 | WP_164096894.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QFB82_RS14660 (QFB82_14660) | 3020812..3021150 | + | 339 | WP_004941561.1 | YegP family protein | - |
QFB82_RS14665 (QFB82_14665) | 3021329..3022681 | + | 1353 | WP_004941558.1 | tRNA 5-hydroxyuridine modification protein YegQ | - |
QFB82_RS14670 (QFB82_14670) | 3023149..3024054 | + | 906 | WP_015378742.1 | lipid kinase YegS | - |
QFB82_RS14675 (QFB82_14675) | 3024315..3025364 | + | 1050 | WP_015378749.1 | class I fructose-bisphosphate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14425.66 Da Isoelectric Point: 8.4983
>T279058 WP_049239890.1 NZ_CP123597:c3020207-3019818 [Serratia marcescens]
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQNMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
MYMFDTNTVSHLFRQHPQVLNVMEKLPPSAVCISSVTEAELRYGVAKRRNKALQNMVEAFLAAVTVYAWDSEAARCYGEM
RANMERKGKIMGAMDQLIAAHAQSRGATLVTNDRAFAMVPGLAVEDWTR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|