Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 2280445..2281076 Replicon chromosome
Accession NZ_CP123597
Organism Serratia marcescens strain RMCH-M26-N

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag QFB82_RS11185 Protein ID WP_019452963.1
Coordinates 2280445..2280843 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A086GDB9
Locus tag QFB82_RS11190 Protein ID WP_004934853.1
Coordinates 2280843..2281076 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFB82_RS11160 (QFB82_11160) 2276016..2276387 + 372 WP_033632743.1 type II toxin-antitoxin system RelE/ParE family toxin -
QFB82_RS11165 (QFB82_11165) 2276384..2276686 + 303 WP_033632742.1 DNA-binding transcriptional regulator -
QFB82_RS11170 (QFB82_11170) 2276689..2277093 - 405 WP_049276998.1 flagellar protein FlhE -
QFB82_RS11175 (QFB82_11175) 2277093..2279171 - 2079 WP_085336693.1 flagellar biosynthesis protein FlhA -
QFB82_RS11180 (QFB82_11180) 2279164..2280315 - 1152 WP_015378261.1 flagellar biosynthesis protein FlhB -
QFB82_RS11185 (QFB82_11185) 2280445..2280843 - 399 WP_019452963.1 type II toxin-antitoxin system VapC family toxin Toxin
QFB82_RS11190 (QFB82_11190) 2280843..2281076 - 234 WP_004934853.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QFB82_RS11195 (QFB82_11195) 2281202..2281846 - 645 WP_004934858.1 protein phosphatase CheZ -
QFB82_RS11200 (QFB82_11200) 2281857..2282246 - 390 WP_004934862.1 chemotaxis response regulator CheY -
QFB82_RS11205 (QFB82_11205) 2282349..2283398 - 1050 WP_015378262.1 chemotaxis response regulator protein-glutamate methylesterase -
QFB82_RS11210 (QFB82_11210) 2283398..2284270 - 873 WP_025159837.1 protein-glutamate O-methyltransferase CheR -
QFB82_RS11215 (QFB82_11215) 2284299..2285924 - 1626 WP_004934871.1 methyl-accepting chemotaxis protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(7-45)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14876.02 Da        Isoelectric Point: 8.4955

>T279056 WP_019452963.1 NZ_CP123597:c2280843-2280445 [Serratia marcescens]
MFSHMLDTNIVIYVIKRRPLEVLEAFNRYAGKMVISSVTYGELVHGVEKSSRPAVNARVVEDFVSRLDILDYGAKAASHY
GNIRAALERQGTPIGVNDLHIAGHARSEGLILVTNNRREFERVDGLRLENWL

Download         Length: 399 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8837.86 Da        Isoelectric Point: 4.7954

>AT279056 WP_004934853.1 NZ_CP123597:c2281076-2280843 [Serratia marcescens]
MTLGSVFTNNRTQAVRLPAEVRFPDTVSKVTVRVVGKERILAPVENTWDSFFCAENEVSDDFLNERAGQHQREREEL

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A086GDB9

References