Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 229108..229729 Replicon chromosome
Accession NZ_CP123597
Organism Serratia marcescens strain RMCH-M26-N

Toxin (Protein)


Gene name Hha Uniprot ID A0A8B4G7F9
Locus tag QFB82_RS01145 Protein ID WP_004940313.1
Coordinates 229108..229311 (-) Length 68 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A2X2G5J9
Locus tag QFB82_RS01150 Protein ID WP_004940312.1
Coordinates 229361..229729 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QFB82_RS01125 (QFB82_01125) 224626..225996 + 1371 WP_213929527.1 amidase -
QFB82_RS01130 (QFB82_01130) 226047..227987 - 1941 WP_033633989.1 NAD(P)/FAD-dependent oxidoreductase -
QFB82_RS01135 (QFB82_01135) 228317..228592 + 276 WP_050501286.1 hypothetical protein -
QFB82_RS01140 (QFB82_01140) 228608..228841 + 234 WP_255296504.1 cytochrome b/b6 domain-containing protein -
QFB82_RS01145 (QFB82_01145) 229108..229311 - 204 WP_004940313.1 HHA domain-containing protein Toxin
QFB82_RS01150 (QFB82_01150) 229361..229729 - 369 WP_004940312.1 Hha toxicity modulator TomB Antitoxin
QFB82_RS01155 (QFB82_01155) 229888..230241 - 354 WP_004940311.1 hypothetical protein -
QFB82_RS01160 (QFB82_01160) 230647..231360 + 714 WP_260952965.1 ABC transporter ATP-binding protein -
QFB82_RS01165 (QFB82_01165) 231357..232214 + 858 WP_033633988.1 metal ABC transporter permease -
QFB82_RS01170 (QFB82_01170) 232239..233117 + 879 WP_049278666.1 metal ABC transporter substrate-binding protein -
QFB82_RS01175 (QFB82_01175) 233226..233366 - 141 WP_004940304.1 type B 50S ribosomal protein L36 -
QFB82_RS01180 (QFB82_01180) 233379..233633 - 255 WP_004940303.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(8-64)

Antitoxin

Biofilm formation regulator YbaJ

(1-118)


Sequences

Toxin        


Download         Length: 68 a.a.        Molecular weight: 8107.37 Da        Isoelectric Point: 6.9756

>T279049 WP_004940313.1 NZ_CP123597:c229311-229108 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR

Download         Length: 204 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 14261.95 Da        Isoelectric Point: 4.4314

>AT279049 WP_004940312.1 NZ_CP123597:c229729-229361 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B4G7F9

Antitoxin

Source ID Structure
AlphaFold DB A0A2X2G5J9

References