Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 229108..229729 | Replicon | chromosome |
| Accession | NZ_CP123597 | ||
| Organism | Serratia marcescens strain RMCH-M26-N | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A8B4G7F9 |
| Locus tag | QFB82_RS01145 | Protein ID | WP_004940313.1 |
| Coordinates | 229108..229311 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A2X2G5J9 |
| Locus tag | QFB82_RS01150 | Protein ID | WP_004940312.1 |
| Coordinates | 229361..229729 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QFB82_RS01125 (QFB82_01125) | 224626..225996 | + | 1371 | WP_213929527.1 | amidase | - |
| QFB82_RS01130 (QFB82_01130) | 226047..227987 | - | 1941 | WP_033633989.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| QFB82_RS01135 (QFB82_01135) | 228317..228592 | + | 276 | WP_050501286.1 | hypothetical protein | - |
| QFB82_RS01140 (QFB82_01140) | 228608..228841 | + | 234 | WP_255296504.1 | cytochrome b/b6 domain-containing protein | - |
| QFB82_RS01145 (QFB82_01145) | 229108..229311 | - | 204 | WP_004940313.1 | HHA domain-containing protein | Toxin |
| QFB82_RS01150 (QFB82_01150) | 229361..229729 | - | 369 | WP_004940312.1 | Hha toxicity modulator TomB | Antitoxin |
| QFB82_RS01155 (QFB82_01155) | 229888..230241 | - | 354 | WP_004940311.1 | hypothetical protein | - |
| QFB82_RS01160 (QFB82_01160) | 230647..231360 | + | 714 | WP_260952965.1 | ABC transporter ATP-binding protein | - |
| QFB82_RS01165 (QFB82_01165) | 231357..232214 | + | 858 | WP_033633988.1 | metal ABC transporter permease | - |
| QFB82_RS01170 (QFB82_01170) | 232239..233117 | + | 879 | WP_049278666.1 | metal ABC transporter substrate-binding protein | - |
| QFB82_RS01175 (QFB82_01175) | 233226..233366 | - | 141 | WP_004940304.1 | type B 50S ribosomal protein L36 | - |
| QFB82_RS01180 (QFB82_01180) | 233379..233633 | - | 255 | WP_004940303.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8107.37 Da Isoelectric Point: 6.9756
>T279049 WP_004940313.1 NZ_CP123597:c229311-229108 [Serratia marcescens]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPTSVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14261.95 Da Isoelectric Point: 4.4314
>AT279049 WP_004940312.1 NZ_CP123597:c229729-229361 [Serratia marcescens]
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
MDEYSPKRHDIAQLKFLCENLYDEGIATLGDSHHGWVNDPTSSVNLQLNELIEHIASFVMSYKIKYMDESDLSELVEEYL
DDTYTLFSSYGINDSDLRRWQKTKARLFRMFSGEDICTTMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4G7F9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2X2G5J9 |