Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 2502282..2502918 | Replicon | chromosome |
| Accession | NZ_CP123578 | ||
| Organism | Priestia megaterium strain HyangYak-01 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | D5DWT4 |
| Locus tag | QEP22_RS13515 | Protein ID | WP_013055004.1 |
| Coordinates | 2502568..2502918 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | D5DWT3 |
| Locus tag | QEP22_RS13510 | Protein ID | WP_013055003.1 |
| Coordinates | 2502282..2502563 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEP22_RS13485 | 2497648..2498619 | + | 972 | WP_280560705.1 | UV DNA damage repair endonuclease UvsE | - |
| QEP22_RS13490 | 2498628..2499230 | - | 603 | WP_043977820.1 | rhomboid family intramembrane serine protease | - |
| QEP22_RS13495 | 2499295..2499660 | + | 366 | WP_043977839.1 | holo-ACP synthase | - |
| QEP22_RS13500 | 2499719..2500777 | + | 1059 | WP_043977822.1 | outer membrane lipoprotein carrier protein LolA | - |
| QEP22_RS13505 | 2500891..2502081 | + | 1191 | WP_280560706.1 | alanine racemase | - |
| QEP22_RS13510 | 2502282..2502563 | + | 282 | WP_013055003.1 | hypothetical protein | Antitoxin |
| QEP22_RS13515 | 2502568..2502918 | + | 351 | WP_013055004.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QEP22_RS13520 | 2503076..2503912 | + | 837 | WP_013055005.1 | RsbT co-antagonist protein RsbRA | - |
| QEP22_RS13525 | 2503915..2504271 | + | 357 | WP_013055006.1 | STAS domain-containing protein | - |
| QEP22_RS13530 | 2504275..2504676 | + | 402 | WP_013055007.1 | anti-sigma regulatory factor | - |
| QEP22_RS13535 | 2504690..2505700 | + | 1011 | WP_013055008.1 | PP2C family protein-serine/threonine phosphatase | - |
| QEP22_RS13540 | 2505760..2506092 | + | 333 | WP_013055009.1 | anti-sigma factor antagonist | - |
| QEP22_RS13545 | 2506089..2506574 | + | 486 | WP_013055010.1 | anti-sigma B factor RsbW | - |
| QEP22_RS13550 | 2506540..2507334 | + | 795 | WP_013055011.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12991.96 Da Isoelectric Point: 4.8781
>T279048 WP_013055004.1 NZ_CP123578:2502568-2502918 [Priestia megaterium]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|