Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 25565..26099 Replicon plasmid paNv_UK9
Accession NZ_CP123570
Organism Arsenophonus nasoniae strain aNv_UK

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QE193_RS24625 Protein ID WP_135678429.1
Coordinates 25818..26099 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QE193_RS24620 Protein ID WP_135678431.1
Coordinates 25565..25831 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE193_RS24565 (QE193_24580) 20648..21616 - 969 WP_280622704.1 DUF2184 domain-containing protein -
QE193_RS24570 (QE193_24585) 21620..22057 - 438 WP_246067523.1 hypothetical protein -
QE193_RS24575 (QE193_24590) 22098..22613 - 516 WP_280622705.1 hypothetical protein -
QE193_RS24580 (QE193_24595) 22582..23178 - 597 WP_280622706.1 DUF2213 domain-containing protein -
QE193_RS24585 (QE193_24600) 23114..23281 - 168 WP_280622707.1 hypothetical protein -
QE193_RS24590 (QE193_24605) 23332..23670 - 339 WP_280622708.1 phage minor head protein -
QE193_RS24595 (QE193_24610) 23576..24142 - 567 WP_280622618.1 hypothetical protein -
QE193_RS24600 (QE193_24615) 24099..24275 - 177 WP_280622617.1 hypothetical protein -
QE193_RS24605 (QE193_24620) 24296..24718 - 423 WP_280622616.1 DUF1073 domain-containing protein -
QE193_RS24610 (QE193_24625) 24724..24945 - 222 WP_280622709.1 hypothetical protein -
QE193_RS24615 (QE193_24630) 24968..25462 - 495 WP_280622710.1 DUF1073 domain-containing protein -
QE193_RS24620 (QE193_24635) 25565..25831 + 267 WP_135678431.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QE193_RS24625 (QE193_24640) 25818..26099 + 282 WP_135678429.1 type II toxin-antitoxin system YafQ family toxin Toxin
QE193_RS24630 (QE193_24645) 26187..26789 - 603 WP_280622711.1 recombinase family protein -
QE193_RS24635 (QE193_24650) 26917..28143 - 1227 WP_135678495.1 PBSX family phage terminase large subunit -
QE193_RS24640 (QE193_24655) 28121..28708 - 588 WP_026824067.1 hypothetical protein -
QE193_RS24645 (QE193_24660) 28971..29966 - 996 WP_167876733.1 tyrosine-type recombinase/integrase -
QE193_RS24650 (QE193_24665) 30040..30453 - 414 WP_135678499.1 hypothetical protein -
QE193_RS24655 (QE193_24670) 30488..30943 - 456 WP_280622712.1 lysis protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..38308 38308
- flank IS/Tn - - 26187..26789 602


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(1-92)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(4-84)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10884.58 Da        Isoelectric Point: 10.4639

>T279047 WP_135678429.1 NZ_CP123570:25818-26099 [Arsenophonus nasoniae]
MRTIERSVTFKRDYKREAKGRHRNNLDKVLISVITSLVIDEPLKTSHRDHDLIGKWSGHRECHIKPDLLLIYRKPDSETL
QLVRLGSHAQLFG

Download         Length: 282 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9816.24 Da        Isoelectric Point: 6.4627

>AT279047 WP_135678431.1 NZ_CP123570:25565-25831 [Arsenophonus nasoniae]
MRHSETYVRARIDANTKQRATAALEAMGLSVSDAIRLLMLRVADEQRLPFDVKVPNTTTKKAIAELEEGKGKQFDCVTAL
MADLHEDN

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References