Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 2275..2933 | Replicon | plasmid paNv_UK7 |
| Accession | NZ_CP123568 | ||
| Organism | Arsenophonus nasoniae strain aNv_UK | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | QE193_RS23730 | Protein ID | WP_135679093.1 |
| Coordinates | 2757..2933 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | QE193_RS23725 | Protein ID | WP_135679091.1 |
| Coordinates | 2275..2691 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QE193_RS23715 (QE193_23720) | 118..711 | + | 594 | WP_135679090.1 | hypothetical protein | - |
| QE193_RS23720 (QE193_23725) | 711..2144 | + | 1434 | WP_246067639.1 | phage terminase large subunit | - |
| QE193_RS23725 (QE193_23730) | 2275..2691 | - | 417 | WP_135679091.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QE193_RS23730 (QE193_23735) | 2757..2933 | - | 177 | WP_135679093.1 | mRNA interferase | Toxin |
| QE193_RS23735 (QE193_23740) | 3255..3500 | - | 246 | WP_246067615.1 | hypothetical protein | - |
| QE193_RS23740 (QE193_23745) | 3487..3579 | - | 93 | WP_280622670.1 | transposase | - |
| QE193_RS23745 (QE193_23750) | 3611..3796 | - | 186 | WP_280622685.1 | hypothetical protein | - |
| QE193_RS23750 (QE193_23755) | 3838..4047 | - | 210 | WP_280622686.1 | transposase | - |
| QE193_RS23755 (QE193_23760) | 4206..4442 | - | 237 | WP_280622687.1 | transposase zinc-binding domain-containing protein | - |
| QE193_RS23760 (QE193_23765) | 4452..4877 | - | 426 | WP_280622688.1 | hypothetical protein | - |
| QE193_RS23765 (QE193_23770) | 4940..5605 | - | 666 | Protein_10 | IS21-like element helper ATPase IstB | - |
| QE193_RS23770 (QE193_23775) | 5556..5696 | - | 141 | WP_280622689.1 | hypothetical protein | - |
| QE193_RS23775 (QE193_23780) | 5683..6718 | - | 1036 | Protein_12 | IS21 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..48029 | 48029 | |
| - | flank | IS/Tn | - | - | 4940..5401 | 461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6630.79 Da Isoelectric Point: 10.9137
>T279046 WP_135679093.1 NZ_CP123568:c2933-2757 [Arsenophonus nasoniae]
VKQSEFLKWLKSQGVKTENGKKHLRLYYKGKISHLPRHGSQELTTGLVEGVKKQLGLK
VKQSEFLKWLKSQGVKTENGKKHLRLYYKGKISHLPRHGSQELTTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15774.23 Da Isoelectric Point: 6.0867
>AT279046 WP_135679091.1 NZ_CP123568:c2691-2275 [Arsenophonus nasoniae]
MFYPAKFTQEDNGYTVSFRDIKDAITCGSSFDEAMSMAEDIILCWIDVYFEKNEFVPMPSDSLYDYEHWVFLPDSIFAKV
LLHNEMLKAKISKAELARLMGTNSPEIQRILSARHKTKIDTISKALSKLGKHLTLSLA
MFYPAKFTQEDNGYTVSFRDIKDAITCGSSFDEAMSMAEDIILCWIDVYFEKNEFVPMPSDSLYDYEHWVFLPDSIFAKV
LLHNEMLKAKISKAELARLMGTNSPEIQRILSARHKTKIDTISKALSKLGKHLTLSLA
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|