Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 25521..26043 Replicon plasmid paNv_UK5
Accession NZ_CP123566
Organism Arsenophonus nasoniae strain aNv_UK

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag QE193_RS22990 Protein ID WP_135678791.1
Coordinates 25521..25802 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag QE193_RS22995 Protein ID WP_135678793.1
Coordinates 25792..26043 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE193_RS22940 (QE193_22950) 20846..21208 + 363 WP_280622619.1 phage minor head protein -
QE193_RS22945 (QE193_22955) 21236..21682 + 447 WP_280622620.1 DUF2213 domain-containing protein -
QE193_RS22950 (QE193_22960) 21778..21936 + 159 WP_280622621.1 hypothetical protein -
QE193_RS22955 (QE193_22965) 21969..22421 + 453 WP_280622622.1 hypothetical protein -
QE193_RS22960 (QE193_22970) 22462..22899 + 438 WP_246067492.1 hypothetical protein -
QE193_RS22965 (QE193_22975) 22903..23871 + 969 WP_135678441.1 DUF2184 domain-containing protein -
QE193_RS22970 (QE193_22980) 23973..24215 + 243 WP_280622623.1 hypothetical protein -
QE193_RS22975 (QE193_22985) 24306..24692 + 387 WP_135678445.1 DUF4054 domain-containing protein -
QE193_RS22980 (QE193_22990) 24692..25162 + 471 WP_280622624.1 hypothetical protein -
QE193_RS22985 (QE193_22995) 25159..25524 + 366 WP_135678789.1 hypothetical protein -
QE193_RS22990 (QE193_23000) 25521..25802 - 282 WP_135678791.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QE193_RS22995 (QE193_23005) 25792..26043 - 252 WP_135678793.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QE193_RS23000 (QE193_23010) 26109..26642 + 534 WP_135678795.1 hypothetical protein -
QE193_RS23005 (QE193_23015) 26632..27324 + 693 WP_135678797.1 DUF3383 family protein -
QE193_RS23010 (QE193_23020) 27461..28213 - 753 WP_280622625.1 transposase -
QE193_RS23015 (QE193_23025) 28141..28653 - 513 WP_280622626.1 transposase zinc-binding domain-containing protein -
QE193_RS23020 (QE193_23030) 28663..29121 - 459 WP_135678771.1 hypothetical protein -
QE193_RS23025 (QE193_23035) 29298..30098 + 801 WP_246067559.1 DUF3383 family protein -
QE193_RS23030 (QE193_23040) 30108..30392 + 285 WP_167876761.1 hypothetical protein -
QE193_RS23035 (QE193_23045) 30505..30963 + 459 WP_135678317.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..62907 62907


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11085.10 Da        Isoelectric Point: 10.6178

>T279045 WP_135678791.1 NZ_CP123566:c25802-25521 [Arsenophonus nasoniae]
MSYSIEFEKRALKEWKKLAHPIREQFKKKLVKVLEYPHIKSAQLHGHQYRYKIKLKSSGYRLVYEVNDNKLLLLVIAVGI
RANNEVYQLASKR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9343.49 Da        Isoelectric Point: 3.8960

>AT279045 WP_135678793.1 NZ_CP123566:c26043-25792 [Arsenophonus nasoniae]
MTYEILTSTVASITDLKRNPMGTVAEAEGNAVAILNRNEPAFYCVPPDLYAYFQELAEDTELNRIADERMKNPEFVSVNI
DEL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References