Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 61568..62204 Replicon plasmid paNv_UK3
Accession NZ_CP123564
Organism Arsenophonus nasoniae strain aNv_UK

Toxin (Protein)


Gene name vapC Uniprot ID A0A4P7L2E3
Locus tag QE193_RS21965 Protein ID WP_026823396.1
Coordinates 61800..62204 (+) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A4P7L1M6
Locus tag QE193_RS21960 Protein ID WP_026823397.1
Coordinates 61568..61807 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QE193_RS21935 (QE193_21945) 56970..57731 - 762 WP_135677409.1 IS21-like element helper ATPase IstB -
QE193_RS21940 (QE193_21950) 57718..58772 - 1055 Protein_57 IS21 family transposase -
QE193_RS21945 (QE193_21955) 58762..59919 - 1158 Protein_58 IS3 family transposase -
QE193_RS21950 (QE193_21960) 60371..61060 + 690 WP_026823399.1 hypothetical protein -
QE193_RS21955 (QE193_21965) 61078..61461 + 384 WP_026823398.1 hypothetical protein -
QE193_RS21960 (QE193_21970) 61568..61807 + 240 WP_026823397.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QE193_RS21965 (QE193_21975) 61800..62204 + 405 WP_026823396.1 type II toxin-antitoxin system VapC family toxin Toxin
QE193_RS21970 (QE193_21980) 62649..63614 + 966 WP_051297076.1 tyrosine-type recombinase/integrase -
QE193_RS21975 (QE193_21985) 63611..63769 + 159 WP_155846998.1 hypothetical protein -
QE193_RS21980 (QE193_21990) 63819..63995 + 177 WP_167876777.1 hypothetical protein -
QE193_RS21985 (QE193_21995) 63997..64431 + 435 WP_026823394.1 hypothetical protein -
QE193_RS21990 (QE193_22000) 64480..65235 + 756 WP_135678964.1 signal peptidase I -
QE193_RS21995 (QE193_22005) 65238..65831 + 594 WP_026823392.1 hypothetical protein -
QE193_RS22000 (QE193_22010) 65809..66177 + 369 WP_026823391.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..135571 135571


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 15217.49 Da        Isoelectric Point: 8.5036

>T279044 WP_026823396.1 NZ_CP123564:61800-62204 [Arsenophonus nasoniae]
MIKYLLDTNIVIFTIKRKPVSLLPKFNQHTNQLAISAITFAELIFGAEKSMNSAKNLATVNDFVSRLTVLPYDEQAAFHY
GDIKANFEKKEKPIGDNDLHIAAHARSKGLVVVTNNTREFERVEGLRIEDWTQL

Download         Length: 405 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9195.27 Da        Isoelectric Point: 4.7420

>AT279044 WP_026823397.1 NZ_CP123564:61568-61807 [Arsenophonus nasoniae]
MIQQGKVFMSNRTQNVRLPADTRFPDDVKDVIVRVKGKERIISPVQNAWDSFFLSEQSVTDDFLSNRTEQITSERESFD

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7L2E3

Antitoxin

Source ID Structure
AlphaFold DB A0A4P7L1M6

References