Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 61568..62204 | Replicon | plasmid paNv_UK3 |
Accession | NZ_CP123564 | ||
Organism | Arsenophonus nasoniae strain aNv_UK |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A4P7L2E3 |
Locus tag | QE193_RS21965 | Protein ID | WP_026823396.1 |
Coordinates | 61800..62204 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A4P7L1M6 |
Locus tag | QE193_RS21960 | Protein ID | WP_026823397.1 |
Coordinates | 61568..61807 (+) | Length | 80 a.a. |
Genomic Context
Location: 60371..61060 (690 bp)
Type: Others
Protein ID: WP_026823399.1
Type: Others
Protein ID: WP_026823399.1
Location: 61078..61461 (384 bp)
Type: Others
Protein ID: WP_026823398.1
Type: Others
Protein ID: WP_026823398.1
Location: 61568..61807 (240 bp)
Type: Antitoxin
Protein ID: WP_026823397.1
Type: Antitoxin
Protein ID: WP_026823397.1
Location: 61800..62204 (405 bp)
Type: Toxin
Protein ID: WP_026823396.1
Type: Toxin
Protein ID: WP_026823396.1
Location: 62649..63614 (966 bp)
Type: Others
Protein ID: WP_051297076.1
Type: Others
Protein ID: WP_051297076.1
Location: 63611..63769 (159 bp)
Type: Others
Protein ID: WP_155846998.1
Type: Others
Protein ID: WP_155846998.1
Location: 63819..63995 (177 bp)
Type: Others
Protein ID: WP_167876777.1
Type: Others
Protein ID: WP_167876777.1
Location: 63997..64431 (435 bp)
Type: Others
Protein ID: WP_026823394.1
Type: Others
Protein ID: WP_026823394.1
Location: 64480..65235 (756 bp)
Type: Others
Protein ID: WP_135678964.1
Type: Others
Protein ID: WP_135678964.1
Location: 65238..65831 (594 bp)
Type: Others
Protein ID: WP_026823392.1
Type: Others
Protein ID: WP_026823392.1
Location: 65809..66177 (369 bp)
Type: Others
Protein ID: WP_026823391.1
Type: Others
Protein ID: WP_026823391.1
Location: 56970..57731 (762 bp)
Type: Others
Protein ID: WP_135677409.1
Type: Others
Protein ID: WP_135677409.1
Location: 57718..58772 (1055 bp)
Type: Others
Protein ID: Protein_57
Type: Others
Protein ID: Protein_57
Location: 58762..59919 (1158 bp)
Type: Others
Protein ID: Protein_58
Type: Others
Protein ID: Protein_58
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QE193_RS21935 (QE193_21945) | 56970..57731 | - | 762 | WP_135677409.1 | IS21-like element helper ATPase IstB | - |
QE193_RS21940 (QE193_21950) | 57718..58772 | - | 1055 | Protein_57 | IS21 family transposase | - |
QE193_RS21945 (QE193_21955) | 58762..59919 | - | 1158 | Protein_58 | IS3 family transposase | - |
QE193_RS21950 (QE193_21960) | 60371..61060 | + | 690 | WP_026823399.1 | hypothetical protein | - |
QE193_RS21955 (QE193_21965) | 61078..61461 | + | 384 | WP_026823398.1 | hypothetical protein | - |
QE193_RS21960 (QE193_21970) | 61568..61807 | + | 240 | WP_026823397.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QE193_RS21965 (QE193_21975) | 61800..62204 | + | 405 | WP_026823396.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QE193_RS21970 (QE193_21980) | 62649..63614 | + | 966 | WP_051297076.1 | tyrosine-type recombinase/integrase | - |
QE193_RS21975 (QE193_21985) | 63611..63769 | + | 159 | WP_155846998.1 | hypothetical protein | - |
QE193_RS21980 (QE193_21990) | 63819..63995 | + | 177 | WP_167876777.1 | hypothetical protein | - |
QE193_RS21985 (QE193_21995) | 63997..64431 | + | 435 | WP_026823394.1 | hypothetical protein | - |
QE193_RS21990 (QE193_22000) | 64480..65235 | + | 756 | WP_135678964.1 | signal peptidase I | - |
QE193_RS21995 (QE193_22005) | 65238..65831 | + | 594 | WP_026823392.1 | hypothetical protein | - |
QE193_RS22000 (QE193_22010) | 65809..66177 | + | 369 | WP_026823391.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..135571 | 135571 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15217.49 Da Isoelectric Point: 8.5036
>T279044 WP_026823396.1 NZ_CP123564:61800-62204 [Arsenophonus nasoniae]
MIKYLLDTNIVIFTIKRKPVSLLPKFNQHTNQLAISAITFAELIFGAEKSMNSAKNLATVNDFVSRLTVLPYDEQAAFHY
GDIKANFEKKEKPIGDNDLHIAAHARSKGLVVVTNNTREFERVEGLRIEDWTQL
MIKYLLDTNIVIFTIKRKPVSLLPKFNQHTNQLAISAITFAELIFGAEKSMNSAKNLATVNDFVSRLTVLPYDEQAAFHY
GDIKANFEKKEKPIGDNDLHIAAHARSKGLVVVTNNTREFERVEGLRIEDWTQL
Download Length: 405 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7L2E3 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7L1M6 |